gvim-9.1.1406-150500.20.27.1<>,QhR p9|vY Mƪ޶-6^jrK/U,#] ɿv1ZAVHJ(?Jd  ,8<HLe R0 n  (  x  * P  . ..dhm(q8x94:!/><@<B<F<G<H=@I=X=Y>@Z>[>\? ]?^@bBIcBdCpeCufCxlCzuCvD wGxHlyH4zIIIIJCgvim9.1.1406150500.20.27.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.hR h02-armsrv2NSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxaarch64/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiL,Px)U C.&F,A큤hR hR hRhRhRhRhRhRhRhRhRhRhRhRhRhRhRhR hRh0hRhRhRhRhRhRhRhRhRhRhRf6ce912e941ec1cfcf02cdc208ef096e990ce26f8089ff22847903f4a2a1182a761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a82010b200a5bad2d5fa2c286b89091cdbc57e1e7bea771121b6b941dc656dc46fa3a6eec36bce6a7817e62c4b15940ab1b42af19292b7ed37d42e268d2c9131b2db708795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0b0685688fa3eabffad030fb2450faff870a4db4fb3179b4bf87b1853cb625b001d203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa09051e24f1bdf0a66bc7c3d3bb811c5229dbe789119d4dde535a1b92872090cb8f7f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f225bbc8b1988690ddf5be1c0cd1847d3128da54cfd66787308238e7825ee36988cb498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.1.1406-150500.20.27.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(aarch-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.28)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.17)(64bit)libm.so.6(GLIBC_2.29)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)libselinux.so.1()(64bit)libselinux.so.1(LIBSELINUX_1.0)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.1.1406-150500.20.27.13.0.4-14.6.0-14.0-15.2-19.1.1406-150500.20.27.1gvim8.24.14.3hQXg͂ggb@gH[@f$eqe]@dܺ@dx@dldZ5dJcd'@ccR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@martin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Fix bsc#1228776 / CVE-2024-41965. - Fix bsc#1239602 / CVE-2025-29768. - Refresh patch: vim-7.3-sh_is_bash.patch - Update to 9.1.1406: 9.1.1406: crash when importing invalid tuple 9.1.1405: tests: no test for mapping with special keys in session file 9.1.1404: wrong link to Chapter 2 in new-tutor 9.1.1403: expansion of 'tabpanelopt' value adds wrong values 9.1.1402: multi-byte mappings not properly stored in session file 9.1.1401: list not materialized in prop_list() 9.1.1400: [security]: use-after-free when evaluating tuple fails 9.1.1399: tests: test_codestyle fails for auto-generated files 9.1.1398: completion: trunc does not follow Pmenu highlighting attributes 9.1.1397: tabpanel not correctly updated on :tabonly 9.1.1396: 'errorformat' is a global option 9.1.1395: search_stat not reset when pattern differs in case 9.1.1394: tabpanel not correctly redrawn on tabonly 9.1.1393: missing test for switching buffers and reusing curbuf 9.1.1392: missing patch number 9.1.1391: Vim does not have a vertical tabpanel 9.1.1390: style: more wrong indentation 9.1.1389: completion: still some issue when 'isexpand' contains a space 9.1.1388: Scrolling one line too far with 'nosmoothscroll' page scrolling 9.1.1387: memory leak when buflist_new() fails to reuse curbuf 9.1.1386: MS-Windows: some minor problems building on AARCH64 9.1.1385: inefficient loop for 'nosmoothscroll' scrolling 9.1.1384: still some problem with the new tutors filetype plugin 9.1.1383: completion: 'isexpand' option does not handle space char correct 9.1.1382: if_ruby: unused compiler warnings from ruby internals 9.1.1381: completion: cannot return to original text 9.1.1380: 'eventignorewin' only checked for current buffer 9.1.1379: MS-Windows: error when running evim when space in path 9.1.1378: sign without text overwrites number option 9.1.1377: patch v9.1.1370 causes some GTK warning messages 9.1.1376: quickfix dummy buffer may remain as dummy buffer 9.1.1375: [security]: possible heap UAF with quickfix dummy buffer 9.1.1374: completion: 'smartcase' not respected when filtering matches 9.1.1373: 'completeopt' checking logic can be simplified 9.1.1372: style: braces issues in various files 9.1.1371: style: indentation and brace issues in insexpand.c 9.1.1370: CI Tests favor GTK2 over GTK3 9.1.1369: configure still using autoconf 2.71 9.1.1368: GTK3 and GTK4 will drop numeric cursor support. 9.1.1367: too many strlen() calls in gui.c 9.1.1366: v9.1.1364 unintentionally changed sign.c and sound.c 9.1.1365: MS-Windows: compile warnings and too many strlen() calls 9.1.1364: style: more indentation issues 9.1.1363: style: inconsistent indentation in various files 9.1.1362: Vim9: type ignored when adding tuple to instance list var 9.1.1361: [security]: possible use-after-free when closing a buffer 9.1.1360: filetype: GNU Radio companion files are not recognized 9.1.1359: filetype: GNU Radio config files are not recognized 9.1.1358: if_lua: compile warnings with gcc15 9.1.1357: Vim incorrectly escapes tags with "[" in a help buffer 9.1.1356: Vim9: crash when unletting variable 9.1.1355: The pum_redraw() function is too complex 9.1.1354: tests: Test_terminalwinscroll_topline() fails on Windows 9.1.1353: missing change from v9.1.1350 9.1.1352: style: inconsistent indent in insexpand.c 9.1.1351: Return value of getcmdline() inconsistent in CmdlineLeavePre 9.1.1350: tests: typo in Test_CmdlineLeavePre_cabbr() 9.1.1349: CmdlineLeavePre may trigger twice 9.1.1348: still E315 with the terminal feature 9.1.1347: small problems with gui_w32.c 9.1.1346: missing out-of-memory check in textformat.c 9.1.1345: tests: Test_xxd_color2() test failure dump diff is misleading 9.1.1344: double free in f_complete_match() (after v9.1.1341) 9.1.1343: filetype: IPython files are not recognized 9.1.1342: Shebang filetype detection can be improved 9.1.1341: cannot define completion triggers 9.1.1340: cannot complete :filetype arguments 9.1.1339: missing out-of-memory checks for enc_to_utf16()/utf16_to_enc() 9.1.1338: Calling expand() interferes with cmdcomplete_info() 9.1.1337: Undo corrupted with 'completeopt' "preinsert" when switching buffer 9.1.1336: comment plugin does not support case-insensitive 'commentstring' 9.1.1335: Coverity complains about Null pointer dereferences 9.1.1334: Coverity complains about unchecked return value 9.1.1333: Coverity: complains about unutilized variable 9.1.1332: Vim9: segfault when using super within a lambda 9.1.1331: Leaking memory with cmdcomplete() 9.1.1330: may receive E315 in terminal 9.1.1329: cannot get information about command line completion 9.1.1328: too many strlen() calls in indent.c 9.1.1327: filetype: nroff detection can be improved 9.1.1326: invalid cursor position after 'tagfunc' 9.1.1325: tests: not checking error numbers properly 9.1.1324: undefined behaviour if X11 connection dies 9.1.1323: b:undo_ftplugin not executed when re-using buffer 9.1.1322: small delete register cannot paste multi-line correctly 9.1.1321: filetype: MS ixx and mpp files are not recognized 9.1.1320: filetype: alsoft config files are not recognized 9.1.1319: Various typos in the code, issue with test_inst_complete.vim 9.1.1318: tests: test_format fails 9.1.1317: noisy error when restoring folds from session fails 9.1.1316: missing memory allocation failure in os_mswin.c 9.1.1315: completion: issue with fuzzy completion and 'completefuzzycollect' 9.1.1314: max allowed string width too small 9.1.1313: compile warning about uninitialized value 9.1.1312: tests: Test_backupskip() fails when HOME is defined 9.1.1311: completion: not possible to limit number of matches 9.1.1310: completion: redundant check for preinsert effect 9.1.1309: tests: no test for 'pummaxwidth' with non-truncated "kind" 9.1.1308: completion: cannot order matches by distance to cursor 9.1.1307: make syntax does not reliably detect different flavors 9.1.1306: completion menu rendering can be improved 9.1.1305: completion menu active after switching windows/tabs 9.1.1304: filetype: some man files are not recognized 9.1.1303: missing out-of-memory check in linematch.c 9.1.1302: Coverity warns about using uninitialized value 9.1.1301: completion: cannot configure completion functions with 'complete' 9.1.1300: wrong detection of -inf 9.1.1299: filetype: mbsyncrc files are not recognized 9.1.1298: define_function() is too long 9.1.1297: Ctrl-D scrolling can get stuck 9.1.1296: completion: incorrect truncation logic 9.1.1295: clientserver: does not handle :stopinsert correctly 9.1.1294: gui tabline menu does not use confirm when closing tabs 9.1.1293: comment plugin does not handle 'exclusive' selection for comment object 9.1.1292: statusline not correctly evaluated 9.1.1291: too many strlen() calls in buffer.c 9.1.1290: tests: missing cleanup in test_filetype.vim 9.1.1289: tests: no test for matchparen plugin with WinScrolled event 9.1.1288: Using wrong window in ll_resize_stack() 9.1.1287: quickfix code can be further improved 9.1.1286: filetype: help files not detected when 'iskeyword' includes ":" 9.1.1285: Vim9: no error message for missing method after "super." 9.1.1284: not possible to configure pum truncation char 9.1.1283: quickfix stack is limited to 10 items 9.1.1282: Build and test failure without job feature 9.1.1281: extra newline output when editing stdin 9.1.1280: trailing additional semicolon in get_matches_in_str() 9.1.1279: Vim9: null_object and null_class are no reserved names 9.1.1278: Vim9: too long functions in vim9type.c 9.1.1277: tests: trailing comment char in test_popupwin 9.1.1276: inline word diff treats multibyte chars as word char 9.1.1275: MS-Windows: Not possible to pass additional flags to Make_mvc 9.1.1274: Vim9: no support for object as variable type 9.1.1273: Coverity warns about using uninitialized value 9.1.1272: completion: in keyword completion Ctrl_P cannot go back after Ctrl_N 9.1.1271: filetype: Power Query files are not recognized 9.1.1270: missing out-of-memory checks in buffer.c 9.1.1269: completion: compl_shown_match is updated when starting keyword completion 9.1.1268: filetype: dax files are not recognized 9.1.1267: Vim9: no support for type list/dict> 9.1.1266: MS-Windows: type conversion warnings 9.1.1265: tests: no tests for typing normal char during completion 9.1.1264: Vim9: error when comparing objects 9.1.1263: string length wrong in get_last_inserted_save() 9.1.1262: heap-buffer-overflow with narrow 'pummaxwidth' value 9.1.1261: No test for 'pummaxwidth' non-truncated items 9.1.1260: Hang when filtering buffer with NUL bytes 9.1.1259: some issues with comment package and tailing spaces 9.1.1258: regexp: max \U and \%U value is limited by INT_MAX 9.1.1257: Mixing vim_strsize() with mb_ptr2cells() in pum_redraw() 9.1.1256: if_python: duplicate tuple data entries 9.1.1255: missing test condition for 'pummaxwidth' setting 9.1.1254: need more tests for the comment plugin 9.1.1253: abort when closing window with attached quickfix data 9.1.1252: typos in code and docs related to 'diffopt' "inline:" 9.1.1251: if_python: build error with tuples and dynamic python 9.1.1250: cannot set the maximum popup menu width 9.1.1249: tests: no test that 'listchars' "eol" doesn't affect "gM" 9.1.1248: compile error when building without FEAT_QUICKFIX 9.1.1247: fragile setup to get (preferred) keys from key_name_entry 9.1.1246: coverity complains about some changes in v9.1.1243 9.1.1245: need some more tests for curly braces evaluation 9.1.1244: part of patch v9.1.1242 was wrong 9.1.1243: diff mode is lacking for changes within lines 9.1.1242: Crash when evaluating variable name 9.1.1241: wrong preprocessort indentation in term.c 9.1.1240: Regression with ic/ac text objects and comment plugin 9.1.1239: if_python: no tuple data type support 9.1.1238: wrong cursor column with 'set splitkeep=screen' 9.1.1237: Compile error with C89 compiler in term.c 9.1.1236: tests: test_comments leaves swapfiles around 9.1.1235: cproto files are outdated 9.1.1234: Compile error when SIZE_MAX is not defined 9.1.1233: Coverity warns about NULL pointer when triggering WinResized 9.1.1232: Vim script is missing the tuple data type 9.1.1231: filetype: SPA JSON files are not recognized 9.1.1230: inconsistent CTRL-C behaviour for popup windows 9.1.1229: the comment plugin can be improved 9.1.1228: completion: current position column wrong after got a match 9.1.1227: no tests for the comment package 9.1.1226: "shellcmdline" completion doesn't work with input() 9.1.1225: extra NULL check in VIM_CLEAR() 9.1.1224: cannot :put while keeping indent 9.1.1223: wrong translation used for encoding failures 9.1.1222: using wrong length for last inserted string 9.1.1221: Wrong cursor pos when leaving Insert mode just after 'autoindent' 9.1.1220: filetype: uv.lock file not recognized 9.1.1219: Strange error with wrong type for matchfuzzy() "camelcase" 9.1.1218: missing out-of-memory check in filepath.c 9.1.1217: tests: typos in test_matchfuzzy.vim 9.1.1216: Pasting the '.' register multiple times may not work 9.1.1215: Patch 9.1.1213 has some issues 9.1.1214: matchfuzzy() can be improved for camel case matches 9.1.1213: cannot :put while keeping indent 9.1.1212: too many strlen() calls in edit.c 9.1.1212: filetype: logrotate'd pacmanlogs are not recognized 9.1.1211: TabClosedPre is triggered just before the tab is being freed 9.1.1210: translation(ru): missing Russian translation for the new tutor 9.1.1209: colorcolumn not drawn after virtual text lines 9.1.1208: MS-Windows: not correctly restoring alternate screen on Win 10 9.1.1207: MS-Windows: build warning in filepath.c 9.1.1206: tests: test_filetype fails when a file is a directory 9.1.1205: completion: preinserted text not removed when closing pum 9.1.1204: MS-Windows: crash when passing long string to expand() 9.1.1203: matchparen keeps cursor on case label in sh filetype 9.1.1202: Missing TabClosedPre autocommand 9.1.1201: 'completefuzzycollect' does not handle dictionary correctly 9.1.1200: cmdline pum not cleared for input() completion 9.1.1199: gvim uses hardcoded xpm icon file 9.1.1198: [security]: potential data loss with zip.vim 9.1.1197: process_next_cpt_value() uses wrong condition 9.1.1196: filetype: config files for container tools are not recognized 9.1.1195: inside try-block: fn body executed with default arg undefined 9.1.1194: filetype: false positive help filetype detection 9.1.1193: Unnecessary use of STRCAT() in au_event_disable() 9.1.1192: Vim crashes with term response debug logging enabled 9.1.1191: tests: test for patch 9.1.1186 doesn't fail without the patch 9.1.1190: C indentation does not detect multibyte labels 9.1.1189: if_python: build error due to incompatible pointer types 9.1.1188: runtime(tera): tera support can be improved 9.1.1187: matchparen plugin wrong highlights shell case statement 9.1.1186: filetype: help files in git repos are not detected 9.1.1185: endless loop with completefuzzycollect and no match found 9.1.1184: Unnecessary use of vim_tolower() in vim_strnicmp_asc() 9.1.1083: "above" virtual text breaks cursorlineopt=number 9.1.1182: No cmdline completion for 'completefuzzycollect' 9.1.1181: Unnecessary STRLEN() calls in insexpand.c 9.1.1180: short-description 9.1.1179: too many strlen() calls in misc2.c 9.1.1178: not possible to generate completion candidates using fuzzy matching 9.1.1177: filetype: tera files not detected- Introduce patch to fix bsc#1235751 (regression). * vim-9.1.1134-revert-putty-terminal-colors.patch - Update to 9.1.1176. Changes: * 9.1.1176: wrong indent when expanding multiple lines * 9.1.1175: inconsistent behaviour with exclusive selection and motion commands * 9.1.1174: tests: Test_complete_cmdline() may fail * 9.1.1173: filetype: ABNF files are not detected * 9.1.1172: [security]: overflow with 'nostartofline' and Ex command in tag file * 9.1.1171: tests: wrong arguments passed to assert_equal() * 9.1.1170: wildmenu highlighting in popup can be improved * 9.1.1169: using global variable for get_insert()/get_lambda_name() * 9.1.1168: wrong flags passed down to nextwild() * 9.1.1167: mark '] wrong after copying text object * 9.1.1166: command-line auto-completion hard with wildmenu * 9.1.1165: diff: regression with multi-file diff blocks * 9.1.1164: [security]: code execution with tar.vim and special crafted tar files * 9.1.1163: $MYVIMDIR is set too late * 9.1.1162: completion popup not cleared in cmdline * 9.1.1161: preinsert requires bot "menu" and "menuone" to be set * 9.1.1160: Ctrl-Y does not work well with "preinsert" when completing items * 9.1.1159: $MYVIMDIR may not always be set * 9.1.1158: :verbose set has wrong file name with :compiler! * 9.1.1157: command completion wrong for input() * 9.1.1156: tests: No test for what patch 9.1.1152 fixes * 9.1.1155: Mode message not cleared after :silent message * 9.1.1154: Vim9: not able to use autoload class accross scripts * 9.1.1153: build error on Haiku * 9.1.1152: Patch v9.1.1151 causes problems * 9.1.1151: too many strlen() calls in getchar.c * 9.1.1150: :hi completion may complete to wrong value * 9.1.1149: Unix Makefile does not support Brazilian lang for the installer * 9.1.1148: Vim9: finding imported scripts can be further improved * 9.1.1147: preview-window does not scroll correctly * 9.1.1146: Vim9: wrong context being used when evaluating class member * 9.1.1145: multi-line completion has wrong indentation for last line * 9.1.1144: no way to create raw strings from a blob * 9.1.1143: illegal memory access when putting a register * 9.1.1142: tests: test_startup fails if $HOME/$XDG_CONFIG_HOME is defined * 9.1.1141: Misplaced comment in readfile() * 9.1.1140: filetype: m17ndb files are not detected * 9.1.1139: [fifo] is not displayed when editing a fifo * 9.1.1138: cmdline completion for :hi is too simplistic * 9.1.1137: ins_str() is inefficient by calling STRLEN() * 9.1.1136: Match highlighting marks a buffer region as changed * 9.1.1135: 'suffixesadd' doesn't work with multiple items * 9.1.1134: filetype: Guile init file not recognized * 9.1.1133: filetype: xkb files not recognized everywhere * 9.1.1132: Mark positions wrong after triggering multiline completion * 9.1.1131: potential out-of-memory issue in search.c * 9.1.1130: 'listchars' "precedes" is not drawn on Tabs. * 9.1.1129: missing out-of-memory test in buf_write() * 9.1.1128: patch 9.1.1119 caused a regression with imports * 9.1.1127: preinsert text is not cleaned up correctly * 9.1.1126: patch 9.1.1121 used a wrong way to handle enter * 9.1.1125: cannot loop through pum menu with multiline items * 9.1.1124: No test for 'listchars' "precedes" with double-width char * 9.1.1123: popup hi groups not falling back to defaults * 9.1.1122: too many strlen() calls in findfile.c * 9.1.1121: Enter does not insert newline with "noselect" * 9.1.1120: tests: Test_registers fails * 9.1.1119: Vim9: Not able to use an autoloaded class from another autoloaded script * 9.1.1118: tests: test_termcodes fails * 9.1.1117: there are a few minor style issues * 9.1.1116: Vim9: super not supported in lambda expressions * 9.1.1115: [security]: use-after-free in str_to_reg() * 9.1.1114: enabling termguicolors automatically confuses users * 9.1.1113: tests: Test_terminal_builtin_without_gui waits 2 seconds * 9.1.1112: Inconsistencies in get_next_or_prev_match() * 9.1.1111: Vim9: variable not found in transitive import * 9.1.1110: Vim tests are slow and flaky * 9.1.1109: cmdexpand.c hard to read * 9.1.1108: 'smoothscroll' gets stuck with 'listchars' "eol" * 9.1.1107: cannot loop through completion menu with fuzzy * 9.1.1106: tests: Test_log_nonexistent() causes asan failure * 9.1.1105: Vim9: no support for protected new() method * 9.1.1104: CI: using Ubuntu 22.04 Github runners * 9.1.1103: if_perl: still some compile errors with Perl 5.38 * 9.1.1102: tests: Test_WinScrolled_Resized_eiw() uses wrong filename- 9.1.1101 is a fix for: bsc#1229685 (CVE-2024-43790) bsc#1229822 (CVE-2024-43802) bsc#1230078 (CVE-2024-45306) bsc#1235695 (CVE-2025-22134) bsc#1236151 (CVE-2025-24014) bsc#1237137 (CVE-2025-1215) - Remove obsoleted patch: * vim-7.3-mktemp_tutor.patch - update to 9.1.1101 * insexpand.c hard to read * tests: Test_log_nonexistent only works on Linux * Update base-syntax, improve variable matching * Vim9: import with extends may crash * leaking memory with completing multi lines * --log with non-existent path causes a crash * if_perl: Perl 5.38 adds new symbols causing link failure * tests: matchparen plugin test wrongly named * Vim9: problem finding implemented method in type hierarchy * runtime(qf): Update syntax file, match second delimiter * tests: output of test ...win32_ctrl_z depends on python version * tests: fix expected return code for python 3.13 on Windows * tests: timeout might be a bit too small * tests: test_terminwscroll_topline2 unreliable * tests: No check when tests are run under Github actions * tests: plugin tests are named inconsistently * Vim9: import with extends may crash * completion doesn't work with multi lines * filetype: cmmt files are not recognized * Unable to persistently ignore events in a window and its buffers * improve syntax highlighting * setreg() doesn't correctly handle mbyte chars in blockwise mode * unexpected DCS responses may cause out of bounds reads * has('bsd') is true for GNU/Hurd * filetype: Mill files are not recognized * GUI late startup leads to uninitialized scrollbars * Add support for lz4 to tar & gzip plugin * Terminal ansi colors off by one after tgc reset * included syntax items do not understand contains=TOP * vim_strnchr() is strange and unnecessary * Vim9: len variable not used in compile_load() * runtime(vim): Update base-syntax, match :debuggreedy count prefix * Strange error when heredoc marker starts with "trim" * tests: test_compiler fails on Windows without Maven * 'diffopt' "linematch" cannot be used with {n} less than 10 * args missing after failing to redefine a function * Cannot control cursor positioning of getchar() * preinsert text completions not deleted with / * getchar() can't distinguish between C-I and Tab * tests: Test_termwinscroll_topline2 fails on MacOS * heap-use-after-free and stack-use-after-scope with :14verbose * no digraph for "Approaches the limit" * not possible to use plural forms with gettext() * too many strlen() calls in userfunc.c * terminal: E315 when dragging the terminal with the mouse * runtime(openPlugin): fix unclosed parenthesis in GetWordUnderCursor() * runtime(doc): Tweak documentation style a bit * tests: test_glvs fails when unarchiver not available * Vim always enables 'termguicolors' in a terminal * completion: input text deleted with preinsert when adding leader * translation(sr): Missing Serbian translation for the tutor * Superfluous cleanup steps in test_ins_complete.vim * runtime(netrw): correct wrong version check * Vim doesn't highlight to be inserted text when completing * runtime(netrw): upstream snapshot of v176 * runtime(dist/vim9): fix regressions in dist#vim9#Open * runtime(hyprlang): fix string recognition * make install fails because of a missing dependency * runtime(asm): add byte directives to syntax script * Vim doesn't work well with TERM=xterm-direct * runtime(filetype): commit 99181205c5f8284a3 breaks V lang detection * runtime: decouple Open and Launch commands and gx mapping from netrw * "nosort" enables fuzzy filtering even if "fuzzy" isn't in 'completeopt' * runtime(just): fix typo in syntax file * runtime(filetype): Improve Verilog detection by checking for modules definition * tests: off-by-one error in CheckCWD in test_debugger.vim * tests: no support for env variables when running Vim in terminal * too many strlen() calls in os_unix.c * insert-completed items are always sorted * crash after scrolling and pasting in silent Ex mode * Makefiles uses non-portable syntax * fuzzymatching doesn't prefer matching camelcase * filetype: N-Tripels and TriG files are not recognized * Vim9: Patch 9.1.1014 causes regressions * translation(sr): Update Serbian messages translation - updade to 9.1.1043 * [security]: segfault in win_line() * update helptags * filetype: just files are not recognized * Update base-syntax, match ternary and falsy operators * Vim9: out-of-bound access when echoing an enum * Vim9: imported type cannot be used as func return type * runtime(kconfig): updated ftplugin and syntax script * runtime(doc): rename last t_BG reference to t_RB * Vim9: comments are outdated * tests: test_channel.py fails with IPv6 * runtime(vim): Update base-syntax, fix is/isnot operator matching * Vim9: confusing error when using abstract method via super * make install fails when using shadowdir * Vim9: memory leak with blob2str() * runtime(tex): add texEmphStyle to texMatchGroup in syntax script * runtime(netrw): upstream snapshot of v175 * Vim9: compiling abstract method fails without return * runtime(c): add new constexpr keyword to syntax file (C23) * tests: shaderslang was removed from test_filetype erroneously * link error when FEAT_SPELL not defined * Coverity complains about insecure data handling * runtime(sh): update syntax script * runtime(c): Add missing syntax test files * filetype: setting bash filetype is backwards incompatible * runtime(c): Update syntax and ftplugin files * the installer can be improved * too many strlen() calls in screen.c * no sanitize check when running linematch * filetype: swc configuration files are not recognized * runtime(netrw): change netrw maintainer * wrong return type of blob2str() * blob2str/str2blob() do not support list of strings * runtime(doc): fix typo in usr_02.txt * Coverity complains about dereferencing NULL pointer * linematch option value not completed * string might be used without a trailing NUL * no way to get current selected item in a async context * filetype: fd ignore files are not recognized * v9.1.0743 causes regression with diff mode * runtime(doc): fix base64 encode/decode examples * Vim9: Patch 9.1.1013 causes a few problems * Not possible to convert string2blob and blob2string * Coverity complains about dereferencing NULL value * Vim9: variable not found in transitive import * runtime(colors): Update colorschemes, include new unokai colorscheme * Vim9: Regression caused by patch v9.1.0646 * runtime(lyrics): support milliseconds in syntax script * runtime(vim): Split Vim legacy and Vim9 script indent tests * Vim9: class interface inheritance not correctly working * popupmenu internal error with some abbr in completion item * filetype: VisualCode setting file not recognized * diff feature can be improved * tests: test for patch 9.1.1006 doesn't fail without the patch * filetype: various ignore are not recognized * tests: Load screendump files with "git vimdumps" * PmenuMatch completion highlight can be combined * completion text is highlighted even with no pattern found * tests: a few termdebug tests are flaky * [security]: heap-buffer-overflow with visual mode * runtime(doc): add package- helptags for included packages * Vim9: unknown func error with interface declaring func var * runtime(filetype): don't detect string interpolation as angular * ComplMatchIns highlight hard to read on light background * runtime(vim): Update base-syntax, highlight literal string quote escape * runtime(editorconfig): set omnifunc to syntaxcomplete func * tests: ruby tests fail with Ruby 3.4 * Vim9: leaking finished exception * runtime(tiasm): use correct syntax name tiasm in syntax script * filetype: TI assembly files are not recognized * too many strlen() calls in drawscreen.c * runtime(xf86conf): add section name OutputClass to syntax script * ComplMatchIns may highlight wrong text * runtime(vim): Update base-syntax, improve ex-bang matching * runtime(doc): clarify buffer deletion on popup_close() * filetype: shaderslang files are not detected * Vim9: not able to use comment after opening curly brace - update to 9.1.0993 * 9.1.0993: New 'cmdheight' behavior may be surprising * runtime(sh): fix typo in Last Change header * 9.1.0992: Vim9: double-free after v9.1.0988 * 9.1.0991: v:stacktrace has wrong type in Vim9 script * runtime(sh): add PS0 to bashSpecialVariables in syntax script * runtime(vim): Remove trailing comma from match_words * runtime(zsh): sync syntax script with upstream repo * runtime(doc): Capitalise the mnemonic "Zero" for the 'z' flag of search() * 9.1.0990: Inconsistent behavior when changing cmdheight * 9.1.0989: Vim9: Whitespace after the final enum value causes a syntax error * runtime(java): Quietly opt out for unsupported markdown.vim versions * runtime(vim): fix failing vim syntax test * 9.1.0988: Vim9: no error when using uninitialized var in new() * runtime(doc): update index.txt * 9.1.0987: filetype: cake files are not recognized * 9.1.0986: filetype: 'jj' filetype is a bit imprecise * runtime(jj): Support diffs in jj syntax * runtime(vim): Update matchit pattern, no Vim9 short names * 9.1.0985: Vim9: some ex commands can be shortened * 9.1.0984: exception handling can be improved * runtime(doc): update doc for :horizontal * runtime(doc): update index.txt, windows.txt and version9.txt * runtime(doc): Tweak documentation about base64 function * runtime(chordpro): update syntax script * 9.1.0983: not able to get the displayed items in complete_info() * runtime(doc): use standard SGR format at :h xterm-true-color * 9.1.0982: TI linker files are not recognized * runtime(vim): update vim generator syntax script * 9.1.0981: tests: typo in test_filetype.vim * 9.1.0980: no support for base64 en-/decoding functions in Vim Script * syntax(sh): Improve the recognition of bracket expressions * runtime(doc): mention how NUL bytes are handled * 9.1.0979: VMS: type warning with $XDG_VIMRC_FILE * 9.1.0978: GUI tests sometimes fail when setting 'scroll' options * 9.1.0977: filetype: msbuild filetypes are not recognized * 9.1.0976: Vim9: missing return statement with throw * 9.1.0975: Vim9: interpolated string expr not working in object methods * 9.1.0974: typo in change of commit v9.1.0873 * 9.1.0973: too many strlen() calls in fileio.c * runtime(sh): set shellcheck as the compiler for supported shells * runtime(doc): Fix enum example syntax * 9.1.0972: filetype: TI linker map files are not recognized * runtime(vim): Improve syntax script generator for Vim Script * 9.1.0971: filetype: SLNX files are not recognized * 9.1.0970: VMS: build errors on VMS architecture * runtime(doc): Fix documentation typos * runtime(doc): update for new keyprotocol option value (after v9.1.0969) * 9.1.0969: ghostty not using kitty protocol by default * 9.1.0968: tests: GetFileNameChecks() isn't fully sorted by filetype name * runtime(doc): update version9.txt for bash filetype * runtime(netrw): update last change header for #16265 * runtime(doc): fix doc error in :r behaviour * 9.1.0967: SpotBugs compiler setup can be further improved * 9.1.0966: Vim9: :enum command can be shortened * runtime(compiler): include a basic bash syntax checker compiler * 9.1.0965: filetype: sh filetype set when detecting the use of bash * runtime(doc): clarify ARCH value for 32-bit in INSTALLpc.txt * 9.1.0963: fuzzy-matching does not prefer full match * 9.1.0962: filetype: bun.lock file is not recognized * runtime(vim): update indentation plugin for Vim script * runtime(doc): tweak documentation style in helphelp.txt * runtime(vim): Update base-syntax, allow parens in default arguments * runtime(doc): mention auto-format using clang-format for sound.c/sign.c * runtime(help): fix typo s/additional/arbitrary/ * runtime(help): Add better support for language annotation highlighting * 9.1.0961: filetype: TI gel files are not recognized * 9.1.0960: filetype: hy history files are not recognized * translation(fi): Fix typoes in Finish menu translation * 9.1.0959: Coverity complains about type conversion * runtime(vim): Use supported syntax in indent tests * 9.1.0958: filetype: supertux2 config files detected as lisp * 9.1.0956: completion may crash, completion highlight wrong with preview window * 9.1.0955: Vim9: vim9compile.c can be further improved * runtime(doc): move help tag E1182 * runtime(graphql): contribute vim-graphql to Vim core * 9.1.0954: popupmenu.c can be improved * 9.1.0953: filetype: APKBUILD files not correctly detected * 9.1.0952: Vim9: missing type checking for any type assignment * 9.1.0951: filetype: jshell files are not recognized * runtime(dockerfile): do not set commentstring in syntax script * 9.1.0950: filetype: fennelrc files are not recognized * runtime(netrw): do not double escape Vim special characters * git: ignore reformatting change of netrw plugin * runtime(netrw): more reformating #16248 * runtime(doc): Add a note about handling symbolic links in starting.txt * 9.1.0949: popups inconsistently shifted to the left * git: ignore reformatting change of netrw plugin * runtime(netrw): change indent size from 1 to 2 * 9.1.0948: Missing cmdline completion for :pbuffer * runtime(tutor): Reformat tutor1 * 9.1.0947: short-description * 9.1.0946: cross-compiling fails on osx-arm64 * 9.1.0945: ComplMatchIns highlight doesn't end after inserted text * translation(sv): re-include the change from #16240 * 9.1.0944: tests: test_registers fails when not run under X11 * 9.1.0943: Vim9: vim9compile.c can be further improved * runtime(doc): Update README and mention make check to verify * translation(sv): partly revert commit 98874dca6d0b60ccd6fc3a140b3ec * runtime(vim): update base-syntax after v9.1.0936 * 9.1.0942: a few typos were found * 9.1.0941: ComplMatchIns doesn't work after multibyte chars * runtime(doc): Fix style in fold.txt * translation(sv): Fix typo in Swedish translation * 9.1.0940: Wrong cursor shape with "gq" and 'indentexpr' executes :normal * runtime(doc): fix some small errors * 9.1.0939: make installtutor fails * 9.1.0938: exclusive selection not respected when re-selecting block mode * 9.1.0937: test_undolist() is flaky * 9.1.0936: cannot highlight completed text * 9.1.0935: SpotBugs compiler can be improved * 9.1.0934: hard to view an existing buffer in the preview window * runtime(doc): document how to minimize fold computation costs * 9.1.0933: Vim9: vim9compile.c can be further improved * 9.1.0932: new Italian tutor not installed * runtime(doc): fix a few minor errors from the last doc updates * translation(it): add Italian translation for the interactive tutor * runtime(doc): update the change.txt help file * runtime(help): Add Vim lang annotation support for codeblocks * 9.1.0931: ml_get error in terminal buffer * 9.1.0930: tests: test_terminal2 may hang in GUI mode * 9.1.0929: filetype: lalrpop files are not recognized * 9.1.0928: tests: test_popupwin fails because the filter command fails * editorconfig: set trim_trailing_whitespace = false for src/testdir/test*.vim * 9.1.0927: style issues in insexpand.c * 9.1.0926: filetype: Pixi lock files are not recognized * runtime(doc): Add a reference to |++opt| and |+cmd| at `:h :pedit` * runtime(doc): add a note about inclusive motions and exclusive selection * 9.1.0925: Vim9: expression compiled when not necessary * 9.1.0924: patch 9.1.0923 causes issues * 9.1.0923: too many strlen() calls in filepath.c * 9.1.0923: wrong MIN macro in popupmenu.c * 9.1.0921: popupmenu logic is a bit convoluted * 9.1.0920: Vim9: compile_assignment() too long * 9.1.0919: filetype: some assembler files are not recognized * runtime(netrw): do not pollute search history with symlinks * 9.1.0918: tiny Vim crashes with fuzzy buffer completion * 9.1.0917: various vartabstop and shiftround bugs when shifting lines * runtime(typst): add definition lists to formatlistpat, update maintainer * 9.1.0916: messages.c is exceeding 80 columns * runtime(proto): include filetype plugin for protobuf * 9.1.0915: GVim: default font size a bit too small * 9.1.0914: Vim9: compile_assignment() is too long * 9.1.0913: no error check for neg values for 'messagesopt' * runtime(netrw): only check first arg of netrw_browsex_viewer for being executable * 9.1.0912: xxd: integer overflow with sparse files and -autoskip * 9.1.0911: Variable name for 'messagesopt' doesn't match short name * 9.1.0910: 'messagesopt' does not check max wait time * runtime(doc): update wrong Vietnamese localization tag * 9.1.0909: Vim9: crash when calling instance method - update to 9.1.0908 * refresh vim-7.3-mktemp_tutor.patch * 9.1.0908: not possible to configure :messages * 9.1.0907: printoptions:portrait does not change postscript Orientation * runtime(doc): Add vietnamese.txt to helps main TOC * 9.1.0906: filetype: Nvidia PTX files are not recognized * runtime(doc): updated version9.txt with changes from v9.1.0905 * 9.1.0905: Missing information in CompleteDone event * 9.1.0904: Vim9: copy-paste error in class_defining_member() * 9.1.0903: potential overflow in spell_soundfold_wsal() * runtime(netrw): do not detach when launching external programs in gvim * runtime(doc): make tag alignment more consistent in filetype.txt * runtime(doc): fix wrong syntax and style of vietnamese.txt * translation(it): update Italian manpage for vimtutor * runtime(lua): add optional lua function folding * Filelist: include translations for Chapter 2 tutor * translation(vi): Update Vietnamese translation * runtime(doc): include vietnamese.txt * runtime(tutor): fix another typo in tutor2 * runtime(doc): fix typo in vimtutor manpage * translation(it): update Italian manpage for vimtutor * translation(it): include Italian version of tutor chapter 2 * runtime(tutor): regenerated some translated tutor1 files * runtime(tutor): fix typo in Chapter 2 * 9.1.0902: filetype: Conda configuration files are not recognized * runtime(doc): Tweak documentation style a bit * runtime(tutor): update the tutor files and re-number the chapters * runtime(tutor): Update the makefiles for tutor1 and tutor2 files * 9.1.0901: MS-Windows: vimtutor batch script can be improved * runtime(doc): remove buffer-local completeopt todo item * 9.1.0900: Vim9: digraph_getlist() does not accept bool arg * runtime(typst): provide a formatlistpat in ftplugin * runtime(doc): Update documentation for "noselect" in 'completeopt' * 9.1.0899: default for 'backspace' can be set in C code * runtime(helptoc): reload cached g:helptoc.shell_prompt when starting toc * translation(ru): Updated messages translation * 9.1.0898: runtime(compiler): pytest compiler not included * 9.1.0897: filetype: pyrex files are not detected * runtime(compiler): update eslint compiler * 9.1.0896: completion list wrong after v9.1.0891 * runtime(doc): document changed default value for 'history' * 9.1.0895: default history value is too small * 9.1.0894: No test for what the spotbug compiler parses * 9.1.0893: No test that undofile format does not regress * translation(de): update German manpages * runtime(compiler): include spotbugs Java linter * 9.1.0892: the max value of 'tabheight' is limited by other tabpages * runtime(po): remove poDiffOld/New, add po-format flags to syntax file * 9.1.0891: building the completion list array is inefficient * patch 9.1.0890: %! item not allowed for 'rulerformat' * runtime(gzip): load undofile if there exists one * 9.1.0889: Possible unnecessary redraw after adding/deleting lines * 9.1.0888: leftcol property not available in getwininfo() * 9.1.0887: Wrong expression in sign.c * 9.1.0886: filetype: debian control file not detected * runtime(c3): include c3 filetype plugin * 9.1.0885: style of sign.c can be improved * 9.1.0884: gcc warns about uninitialized variable * runtime(apache): Update syntax directives for apache server 2.4.62 * translation(ru): updated vimtutor translation, update MAINTAINERS file * 9.1.0883: message history cleanup is missing some tests * runtime(doc): Expand docs on :! vs. :term * runtime(netrw): Fixing powershell execution issues on Windows * 9.1.0882: too many strlen() calls in insexpand.c * 9.1.0881: GUI: message dialog may not get focus * runtime(netrw): update netrw's decompress logic * runtime(apache): Update syntax keyword definition * runtime(misc): add Italian LICENSE and (top-level) README file * 9.1.0880: filetype: C3 files are not recognized * runtime(doc): add helptag for :HelpToc command * 9.1.0879: source is not consistently formatted * Add clang-format config file * runtime(compiler): fix escaping of arguments passed to :CompilerSet * 9.1.0878: termdebug: cannot enable DEBUG mode * 9.1.0877: tests: missing test for termdebug + decimal signs * 9.1.0876: filetype: openCL files are not recognized * 9.1.0875: filetype: hyprlang detection can be improved * 9.1.0874: filetype: karel files are not detected * 9.1.0873: filetype: Vivado files are not recognized * 9.1.0872: No test for W23 message * 9.1.0871: getcellpixels() can be further improved * 9.1.0870: too many strlen() calls in eval.c * 9.1.0869: Problem: curswant not set on gm in folded line * 9.1.0868: the warning about missing clipboard can be improved * runtime(doc): Makefile does not clean up all temporary files * 9.1.0867: ins_compl_add() has too many args * editorconfig: don't trim trailing whitespaces in runtime/doc * translation(am): Remove duplicate keys in desktop files * runtime(doc): update helptags * runtime(filetype): remove duplicated *.org file pattern * runtime(cfg): only consider leading // as starting a comment * 9.1.0866: filetype: LLVM IR files are not recognized * 9.1.0865: filetype: org files are not recognized * 9.1.0864: message history is fixed to 200 * 9.1.0863: getcellpixels() can be further improved * runtime(sh): better function support for bash/zsh in indent script * runtime(netrw): small fixes to netrw#BrowseX * 9.1.0862: 'wildmenu' not enabled by default in nocp mode * runtime(doc): update how to report issues for mac Vim * runtime(doc): mention option-backslash at :h CompilerSet * runtime(compiler): include a Java Maven compiler plugin * runtime(racket): update Racket runtime files * runtime(doc): improve indentation in examples for netrw-handler * runtime(doc): improve examples for netrw-handler functions * runtime(idris2): include filetype,indent+syntax plugins for (L)Idris2 + ipkg * runtime(doc): clarify the use of filters and external commands * 9.1.0861: Vim9: no runtime check for object member access of any var * runtime(compiler): update pylint linter * 9.1.0860: tests: mouse_shape tests use hard code sleep value * 9.1.0859: several problems with the GLVS plugin * 9.1.0858: Coverity complains about dead code * runtime(tar): Update tar.vim to support permissions * 9.1.0857: xxd: --- is incorrectly recognized as end-of-options * 9.1.0851: too many strlen() calls in getchar.c * 9.1.0850: Vim9: cannot access nested object inside objects * runtime(tex): extra Number highlighting causes issues * runtime(vim): Fix indent after :silent! function * 9.1.0849: there are a few typos in the source * runtime(netrw): directory symlink not resolved in tree view * runtime(doc): add a table of supported Operating Systems * runtime(tex): update Last Change header in syntax script * runtime(doc): fix typo in g:termdebug_config * runtime(vim): Update base-syntax, improve :normal highlighting * runtime(tex): add Number highlighting to syntax file * runtime(doc): Tweak documentation style a bit * 9.1.0848: if_lua: v:false/v:true are not evaluated to boolean * runtime(dune): use :setl instead of :set in ftplugin * runtime(termdebug): allow to use decimal signs * translation(it): Updated Italian vimtutor * runtime(compiler): improve cppcheck * git: git-blame-ignore-revs shown as an error on Github * 9.1.0847: tests: test_popupwin fails because of updated help file * 9.1.0846: debug symbols for xxd are not cleaned in Makefile * runtime(structurizr): Update structurizr syntax * runtime(8th): updated 8th syntax * runtime(doc): Add pi_tutor.txt to help TOC * runtime(compiler): add mypy and ruff compiler; update pylint linter * runtime(netrw): fix several bugs in netrw tree listing * runtime(netrw): prevent polluting the search history * 9.1.0845: vimtutor shell script can be improved * 9.1.0844: if_python: no way to pass local vars to python * 9.1.0843: too many strlen() calls in undo.c * runtime(doc): update default value for fillchars option * runtime(compiler): fix typo in cppcheck compiler plugin * runtime(doc): simplify vimtutor manpage a bit more * runtime(matchparen): Add matchparen_disable_cursor_hl config option * 9.1.0842: not checking for the sync() systemcall * 9.1.0841: tests: still preferring python2 over python3 * 9.1.0840: filetype: idris2 files are not recognized * 9.1.0839: filetype: leo files are not recognized * runtime(cook): include cook filetype plugin * runtime(debversions): Update Debian versions * patch 9.1.0838: vimtutor is bash-specific * runtime(doc): add help specific modeline to pi_tutor.txt * Filelist: vimtutor chapter 2 is missing in Filelist * 9.1.0837: cross-compiling has some issues * runtime(vimtutor): Add a second chapter- Fix for bsc#1234333 / bsc#1234214 / bsc#1234245. These three bugs all have the same root cause: Package 'xxd' has been obsoleted by Vim, as it provides the xxd files directly. However, because the "Obsoletes" entry was versioned, depending on which version of 'xxd' that is installed, the "Obsoletes" isn't actually triggered. Thus, there is a conflict between "vim" and "xxd" in these cases. Fixing this by removing the version completely. The 'vim' package should always replace 'xxd', even if people are migrating from an older SLE15 service pack which has the exact same version.- Fix for bsc#1231373 / CVE-2024-47814. - Fix for bsc#1229238 / CVE-2024-43374. - update to 9.1.0836 * 9.1.0836: The vimtutor can be improved * 9.1.0835: :setglobal doesn't work properly for 'ffu' and 'tsrfu' * 9.1.0834: tests: 2html test fails * 9.1.0833: CI: recent ASAN changes do not work for indent tests * 9.1.0832: :set doesn't work for 'cot' and 'bkc' after :setlocal * runtime(doc): update help-toc description * runtime(2html): Make links use color scheme colors in TOhtml * 9.1.0831: 'findexpr' can't be used as lambad or Funcref * Filelist: include helptoc package * runtime(doc): include a TOC Vim9 plugin * Filelist: ignore .git-blame-ignore-revs * 9.1.0830: using wrong highlight group for spaces for popupmenu * runtime(typst): synchronize updates from the upstream typst.vim * git: ignore reformatting commit for git-blame (after v9.1.0829) * 9.1.0829: Vim source code uses a mix of tabs and spaces * 9.1.0828: string_T struct could be used more often * 9.1.0827: CI: tests can be improved * runtime(doc): remove stray sentence in pi_netrw.txt * 9.1.0826: filetype: sway files are not recognized * runtime(doc): Include netrw-gp in TOC * runtime(doc): mention 'iskeyword' at :h charclass() * runtime(doc): update help tags * 9.1.0825: compile error for non-diff builds * runtime(netrw): fix E874 when browsing remote directory which contains `~` character * runtime(doc): update coding style documentation * runtime(debversions): Add plucky (25.04) as Ubuntu release name * 9.1.0824: too many strlen() calls in register.c * 9.1.0823: filetype: Zephyr overlay files not recognized * runtime(doc): Clean up minor formatting issues for builtin functions * runtime(netrw): make :Launch/Open autoloadable * runtime(netrw): fix regression with x mapping on Cygwin * runtime(netrw): fix filetype detection for remote files * 9.1.0822: topline might be changed in diff mode unexpectedly * CI: huge linux builds should also run syntax & indent tests * 9.1.0821: 'findexpr' completion doesn't set v:fname to cmdline argument * 9.1.0820: tests: Mac OS tests are too flaky * runtime(awk): Highlight more awk comments in syntax script * runtime(netrw): add missing change for s:redir() * 9.1.0819: tests: using findexpr and imported func not tested * runtime(netrw): improve netrw's open-handling further * runtime(netrw): fix syntax error in netrwPlugin.vim * runtime(netrw): simplify gx file handling * 9.1.0818: some global functions are only used in single files * 9.1.0817: termdebug: cannot evaluate expr in a popup * runtime(defaults): Detect putty terminal and switch to dark background * 9.1.0816: tests: not clear what tests cause asan failures * runtime(doc): Remove some completed items from todo.txt * 9.1.0815: "above" virtual text causes wrong 'colorcolumn' position * runtime(syntax-tests): tiny vim fails because of line-continuation * 9.1.0814: mapset() may remove unrelated mapping * 9.1.0813: no error handling with setglobal and number types * 9.1.0812: Coverity warns about dereferencing NULL ptr * 9.1.0811: :find expansion does not consider 'findexpr' * 9.1.0810: cannot easily adjust the |:find| command * 9.1.0809: filetype: petalinux config files not recognized * 9.1.0808: Terminal scrollback doesn't shrink when decreasing 'termwinscroll' * 9.1.0807: tests: having 'nolist' in modelines isn't always desired * 9.1.0806: tests: no error check when setting global 'briopt' * 9.1.0805: tests: minor issues in gen_opt_test.vim * 9.1.0804: tests: no error check when setting global 'cc' * 9.1.0803: tests: no error check when setting global 'isk' * 9.1.0802: tests: no error check when setting global 'fdm' to empty value * 9.1.0801: tests: no error check when setting global 'termwinkey' * 9.1.0800: tests: no error check when setting global 'termwinsize' * runtime(doc): :ownsyntax also resets 'spelloptions' * 9.1.0799: tests: gettwinvar()/gettabwinvar() tests are not comprehensive * runtime(doc): Fix wrong Mac default options * 9.1.0798: too many strlen() calls in cmdhist.c * 9.1.0797: testing of options can be further improved * 9.1.0796: filetype: libtool files are not recognized * (typst): add folding to typst ftplugin * runtime(netrw): deprecate and remove netrwFileHandlers#Invoke() * 9.1.0795: filetype: Vivado memory info file are not recognized * 9.1.0794: tests: tests may fail on Windows environment * runtime(doc): improve the :colorscheme documentation * 9.1.0793: xxd: -e does add one extra space * 9.1.0792: tests: Test_set_values() is not comprehensive enough * runtime(swayconfig): add flag for bindsym/bindcode to syntax script * 9.1.0791: tests: errors in gen_opt_test.vim are not shown * runtime(compiler): check for compile_commands in build dirs for cppcheck * 9.1.0790: Amiga: AmigaOS4 build should use default runtime (newlib) * runtime(help): Update help syntax * runtime(help): fix end of sentence highlight in code examples * runtime(jinja): Support jinja syntax as secondary filetype * 9.1.0789: tests: ':resize + 5' has invalid space after '+' * 9.1.0788: 27;u is not decoded to literal Escape in kitty/foot * 9.1.0787: cursor position changed when using hidden terminal * 9.1.0786: tests: quickfix update test does not test location list * runtime(doc): add some docs for file-watcher programs * CI: uploading failed screendumps still fails on Cirrus CI * 9.1.0785: cannot preserve error position when setting quickfix list * 9.1.0784: there are several problems with python 3.13 * 9.1.0783: 'spell' option setting has problems * 9.1.0782: tests: using wrong neomuttlog file name * runtime(doc): add preview flag to statusline example * 9.1.0781: tests: test_filetype fails * 9.1.0780: MS-Windows: incorrect Win32 error checking * 9.1.0779: filetype: neomuttlog files are not recognized * 9.1.0778: filetype: lf config files are not recognized * runtime(comment): fix commment toggle with mixed tabs & spaces * runtime(misc): Use consistent "Vim script" spelling * runtime(gleam): add ftplugin for gleam files * runtime(doc): link help-writing from write-local-help * 9.1.0777: filetype: Some upstream php files are not recognized * runtime(java): Define javaBlockStart and javaBlockOtherStart hl groups * runtime(doc): mention conversion rules for remote_expr() * runtime(tutor): Fix missing :s command in spanish translation section 4.4 * 9.1.0776: test_strftime may fail because of missing TZ data * translation(am): Add Armenian language translation * 9.1.0775: tests: not enough tests for setting options * 9.1.0774: "shellcmdline" doesn't work with getcompletion() * 9.1.0773: filetype: some Apache files are not recognized * 9.1.0772: some missing changes from v9.1.0771 * 9.1.0771: completion attribute hl_group is confusing * 9.1.0770: current command line completion is a bit limited * 9.1.0769: filetype: MLIR files are not recognized * 9.1.0768: MS-Windows: incorrect cursor position when restoring screen * runtime(nasm): Update nasm syntax script * 9.1.0767: A condition is always true in ex_getln.c * runtime(skill): Update syntax file to fix string escapes * runtime(help): highlight CTRL- correctly * runtime(doc): add missing usr_52 entry to toc * 9.1.0766: too many strlen() calls in ex_getln.c * runtime(doc): correct `vi` registers 1-9 documentation error * 9.1.0765: No test for patches 6.2.418 and 7.3.489 * runtime(spec): set comments and commentstring options * NSIS: Include libgcc_s_sjlj-1.dll again * runtime(doc): clarify the effect of 'startofline' option * 9.1.0764: [security]: use-after-free when closing a buffer * runtime(vim): Update base-syntax file, improve class, enum and interface highlighting * 9.1.0763: tests: cannot run single syntax tests * 9.1.0762: 'cedit', 'termwinkey' and 'wildchar' may not be parsed correctly * 9.1.0761: :cd completion fails on Windows with backslash in path * 9.1.0760: tests: no error reported, if gen_opt_test.vim fails * 9.1.0759: screenpos() may return invalid position * runtime(misc): unset compiler in various ftplugins * runtime(doc): update formatting and syntax * runtime(compiler): add cppcheck linter compiler plugin * runtime(doc): Fix style in documents * runtime(doc): Fix to two-space convention in user manual * runtime(comment): consider &tabstop in lines after whitespace indent * 9.1.0758: it's possible to set an invalid key to 'wildcharm' * runtime(java): Manage circularity for every :syn-included syntax file * 9.1.0757: tests: messages files contains ANSI escape sequences * 9.1.0756: missing change from patch v9.1.0754 * 9.1.0755: quickfix list does not handle hardlinks well * runtime(doc): 'filetype', 'syntax' and 'keymap' only allow alphanumeric + some characters * runtime(systemd): small fixes to &keywordprg in ftplugin * CI: macos-12 runner is being sunset, switch to 13 * 9.1.0754: fixed order of items in insert-mode completion menu * runtime(comment): commenting might be off by one column * 9.1.0753: Wrong display when typing in diff mode with 'smoothscroll' * 9.1.0752: can set 'cedit' to an invalid value * runtime(doc): add `usr` tag to usr_toc.txt * 9.1.0751: Error callback for term_start() not used * 9.1.0750: there are some Win9x legacy references * runtime(java): Recognise the CommonMark form (///) of Javadoc comments * 9.1.0749: filetype: http files not recognized * runtime(comment): fix syntax error * CI: uploading failed screendump tests does not work Cirrus * 9.1.0748: :keep* commmands are sometimes misidentified as :k * runtime(indent): allow matching negative numbers for gnu indent config file * runtime(comment): add gC mapping to (un)comment rest of line * 9.1.0747: various typos in repo found * 9.1.0746: tests: Test_halfpage_longline() fails on large terminals * runtime(doc): reformat gnat example * runtime(doc): reformat ada_standard_types section * 9.1.0745: filetype: bun and deno history files not recognized * runtime(glvs): Correct the tag name of glvs-autoinstal * runtime(doc): include short form for :earlier/:later * runtime(doc): remove completed TODO * 9.1.0744: filetype: notmuch configs are not recognised * 9.1.0743: diff mode does not handle overlapping diffs correctly * runtime(glvs): fix a few issues * runtime(doc): Fix typo in :help :command-modifiers * 9.1.0742: getcmdprompt() implementation can be improved * runtime(docs): update `:set?` command behavior table * runtime(doc): update vim90 to vim91 in docs * runtime(doc): fix typo in :h dos-colors * 9.1.0741: No way to get prompt for input()/confirm() * runtime(doc): fix typo in version9.txt nrformat -> nrformats * runtime(rmd,rrst): 'fex' option not properly restored * runtime(netrw): remove extraneous closing bracket * 9.1.0740: incorrect internal diff with empty file * 9.1.0739: [security]: use-after-free in ex_getln.c * runtime(filetype): tests: Test_filetype_detection() fails * runtime(dist): do not output a message if executable is not found * 9.1.0738: filetype: rapid files are not recognized * runtime(modconf): remove erroneous :endif in ftplugin * runtime(lyrics): support multiple timestamps in syntax script * runtime(java): Optionally recognise _module_ import declarations * runtime(vim): Update base-syntax, improve folding function matches * CI: upload failed screendump tests also for Cirrus * 9.1.0737: tests: screendump tests may require a bit more time * runtime(misc): simplify keywordprg in various ftplugins * runtime(java): Optionally recognise all primitive constants in _switch-case_ labels * runtime(zsh,sh): set and unset compiler in ftplugin * runtime(netrw): using inefficient highlight pattern for 'mf' * 9.1.0736: Unicode tables are outdated * 9.1.0735: filetype: salt files are not recognized * 9.1.0734: filetype: jinja files are not recognized * runtime(zathurarc): add double-click-follow to syntax script * translation(ru): Updated messages translation * translation(it): updated xxd man page * translation(ru): updated xxd man page * 9.1.0733: keyword completion does not work with fuzzy * 9.1.0732: xxd: cannot use -b and -i together * runtime(java): Highlight javaConceptKind modifiers with StorageClass * runtime(doc): reword and reformat how to use defaults.vim * 9.1.0731: inconsistent case sensitive extension matching * runtime(vim): Update base-syntax, match Vim9 bool/null literal args to :if/:while/:return * runtime(netrw): delete confirmation not strict enough * 9.1.0730: Crash with cursor-screenline and narrow window * 9.1.0729: Wrong cursor-screenline when resizing window * 9.1.0728: [security]: heap-use-after-free in garbage collection with location list user data * runtime(doc): clarify the effect of the timeout for search()-functions * runtime(idlang): update syntax script * runtime(spec): Recognize epoch when making spec changelog in ftplugin * runtime(spec): add file triggers to syntax script * 9.1.0727: too many strlen() calls in option.c * runtime(make): add compiler/make.vim to reset compiler plugin settings * runtime(java): Recognise all available standard doclet tags * 9.1.0726: not using correct python3 API with dynamic linking * runtime(dosini): Update syntax script, spellcheck comments only * runtime(doc): Revert outdated comment in completeopt's fuzzy documentation * 9.1.0725: filetype: swiftinterface files are not recognized * runtime(pandoc): Update compiler plugin to use actual 'spelllang' * runtime(groff): Add compiler plugin for groff * 9.1.0724: if_python: link error with python 3.13 and stable ABI * 9.1.0723: if_python: dynamic linking fails with python3 >= 3.13 * 9.1.0722: crash with large id in text_prop interface * 9.1.0721: tests: test_mksession does not consider XDG_CONFIG_HOME * runtime(glvs): update GetLatestVimScripts plugin * runtime(doc): Fix typo in :help :hide text * runtime(doc): buffers can be re-used * 9.1.0720: Wrong breakindentopt=list:-1 with multibyte or TABs * 9.1.0719: Resetting cell widths can make 'listchars' or 'fillchars' invalid * runtime(doc): Update version9.txt and mention $MYVIMDIR - Update to 9.1.0718: * v9.1.0718: hard to know the users personal Vim Runtime Directory * v9.1.0717: Unnecessary nextcmd NULL checks in parse_command_modifiers() Maintainers: fix typo in author name * v9.1.0716: resetting setcellwidth( doesn't update the screen runtime(hcl,terraform): Add runtime files for HCL and Terraform runtime(tmux): Update syntax script * v9.1.0715: Not correctly parsing color names (after v9.1.0709) * v9.1.0714: GuiEnter_Turkish test may fail * v9.1.0713: Newline causes E749 in Ex mode * v9.1.0712: missing dependency of Test_gettext_makefile * v9.1.0711: test_xxd may file when using different xxd * v9.1.0710: popup window may hide part of Command line runtime(vim): Update syntax, improve user-command matching * v9.1.0709: GUIEnter event not found in Turkish locale runtime(sudoers): improve recognized Runas_Spec and Tag_Spec items * v9.1.0708: Recursive window update does not account for reset skipcol runtime(nu): include filetype plugin * v9.1.0707: invalid cursor position may cause a crash * v9.1.0706: test_gettext fails when using shadow dir CI: Install locales-all package * v9.1.0705: Sorting of fuzzy filename completion is not stable translation(pt): update Portuguese/Brazilian menu translation runtime(vim): Update base-syntax, match bracket mark ranges runtime(doc): Update :help :command-complete list * v9.1.0704: inserting with a count is inefficient runtime(doc): use mkdir -p to save a command * v9.1.0703: crash with 2byte encoding and glob2regpat() runtime(hollywood): update syn highlight for If-Then statements and For-In-Loops * v9.1.0702: Patch 9.1.0700 broke CI * v9.1.0701: crash with NFA regex engine when searching for composing chars * v9.1.0700: crash with 2byte encoding and glob2regpat() * v9.1.0699: "dvgo" is not always an inclusive motion runtime(java): Provide support for syntax preview features * v9.1.0698: "Untitled" file not removed when running Test_crash1_3 alone * v9.1.0697: heap-buffer-overflow in ins_typebuf * v9.1.0696: installing runtime files fails when using SHADOWDIR runtime(doc): fix typo * v9.1.0695: test_crash leaves Untitled file around translation(br): Update Brazilian translation translation(pt): Update menu_pt_br * v9.1.0694: matchparen is slow on a long line * v9.1.0693: Configure doesn't show result when not using python3 stable abi * v9.1.0692: Wrong patlen value in ex_substitute() * v9.1.0691: stable-abi may cause segfault on Python 3.11 runtime(vim): Update base-syntax, match :loadkeymap after colon and bar runtime(mane): Improve ManBS mapping * v9.1.0690: cannot set special highlight kind in popupmenu translation(pt): Revert and fix wrong Portuguese menu translation files translation(pt): revert Portuguese menu translation translation(br): Update Brazilian translations runtime(vim): Update base-syntax, improve :let-heredoc highlighting * v9.1.0689: buffer-overflow in do_search( with 'rightleft' runtime(vim): Improve heredoc handling for all embedded scripts * v9.1.0688: dereferences NULL pointer in check_type_is_value() * v9.1.0687: Makefile may not install desktop files runtime(man): Fix ManBS runtime(java): Make the bundled &foldtext function optional runtime(netrw): Change line on `mx` if command output exists runtime(netrw): Fix `mf`-selected entry highlighting runtime(htmlangular): add html syntax highlighting translation(it): Fix filemode of Italian manpages runtime(doc): Update outdated man.vim plugin information runtime(zip): simplify condition to detect MS-Windows * v9.1.0686: zip-plugin has problems with special characters runtime(pandoc): escape quotes in &errorformat for pandoc translation(it): updated Italian manpage * v9.1.0685: too many strlen( calls in usercmd.c runtime(doc): fix grammar in :h :keeppatterns runtime(pandoc): refine pandoc compiler settings * v9.1.0684: completion is inserted on Enter with "noselect" translation(ru): update man pages * v9.1.0683: mode( returns wrong value with mapping runtime(doc): remove trailing whitespace in cmdline.txt * v9.1.0682: Segfault with uninitialized funcref * v9.1.0681: Analyzing failed screendumps is hard runtime(doc): more clarification for the :keeppatterns needed * v9.1.0680: VMS does not have defined uintptr_t runtime(doc): improve typedchar documentation for KeyInputPre autocmd runtime(dist): verify that executable is in $PATH translation(it): update Italian manpages runtime(doc): clarify the effect of :keeppatterns after * v9.1.0677 runtime(doc): update Makefile and make it portable between GNU and BSD * v9.1.0679: Rename from w_closing to w_locked is incomplete runtime(colors): update colorschemes runtime(vim): Update base-syntax, improve :let-heredoc highlighting runtime(doc): Updating the examples in the xxd manpage translation(ru): Updated uganda.rux runtime(yaml): do not re-indent when commenting out lines * v9.1.0678: use-after-free in alist_add() * v9.1.0677 :keepp does not retain the substitute pattern translation(ja): Update Japanese translations to latest release runtime(netrw): Drop committed trace lines runtime(netrw): Error popup not always used runtime(netrw): ErrorMsg( may throw E121 runtime(tutor): update Makefile and make it portable between GNU and BSD translation: improve the po/cleanup.vim script runtime(lang): update Makefile and make it portable between GNU and BSD * v9.1.0676: style issues with man pages * v9.1.0675: Patch v9.1.0674 causes problems runtime(dosbatch): Show %%i as an argument in syntax file runtime(dosbatch): Add syn-sync to syntax file runtime(sql, mysql): fix E169: Command too recursive with sql_type_default = "mysql" * v9.1.0674: compiling abstract method fails because of missing return runtime(javascript): fix a few issues with syntax higlighting runtime(mediawiki): fix typo in doc, test for b:did_ftplugin var runtime(termdebug): Fix wrong test for balloon feature runtime(doc): Remove mentioning of the voting feature runtime(doc): add help tags for json + markdown global variables * v9.1.0673: too recursive func calls when calling super-class method runtime(syntax-tests): Facilitate the viewing of rendered screendumps runtime(doc): fix a few style issues * v9.1.0672: marker folds may get corrupted on undo * v9.1.0671 Problem: crash with WinNewPre autocommand * v9.1.0670: po file encoding fails on *BSD during make translation(it): Update Italian translation translation: Stop using msgconv * v9.1.0669: stable python ABI not used by default Update .gitignore and .hgignore files * v9.1.0668: build-error with python3.12 and stable ABI translations: Update generated po files * v9.1.0667: Some other options reset curswant unnecessarily when set * v9.1.0666: assert_equal( doesn't show multibyte string correctly runtime(doc): clarify directory of Vim's executable vs CWD * v9.1.0665 :for loop runtime(proto): Add indent script for protobuf filetype * v9.1.0664: console vim did not switch back to main screen on exit runtime(zip): zip plugin does not work with Vim 9.0 * v9.1.0663: zip test still resets 'shellslash' option runtime(zip): use defer to restore old settings runtime(zip): add a generic Message function runtime(zip): increment base version of zip plugin runtime(zip): raise minimum Vim version to * v9.0 runtime(zip): refactor save and restore of options runtime(zip): remove test for fnameescape runtime(zip): use :echomsg instead of :echo runtime(zip): clean up and remove comments * v9.1.0662: filecopy( may return wrong value when readlink( fails * v9.1.0661: the zip plugin is not tested. runtime(zip): Fix for FreeBSD's unzip command runtime(doc): capitalize correctly * v9.1.0660: Shift-Insert does work on old conhost translation(it): update Italian manpage runtime(lua): add/subtract a 'shiftwidth' after '('/')' in indentexpr runtime(zip): escape '[' on Unix as well * v9.1.0659: MSVC Makefile is a bit hard to read runtime(doc): fix typo in syntax.txt runtime(doc): -x is only available when compiled with crypt feature * v9.1.0658: Coverity warns about dereferencing NULL pointer. runtime(colors): update Todo highlight in habamax colorscheme * v9.1.0657: MSVC build time can be optimized * v9.1.0656: MSVC Makefile CPU handling can be improved * v9.1.0655: goaccess config file not recognized CI: update clang compiler to version 20 runtime(netrw): honor `g:netrw_alt{o,v}` for `:{S,H,V}explore` * v9.1.0654: completion does not respect completeslash with fuzzy * v9.1.0653: Patch v9.1.0648 not completely right * v9.1.0652: too many strlen( calls in syntax.c * v9.1.0651 :append * v9.1.0650: Coverity warning in cstrncmp() * v9.1.0649: Wrong comment for "len" argument of call_simple_func() * v9.1.0648: [security] double-free in dialog_changed() * v9.1.0647: [security] use-after-free in tagstack_clear_entry runtime(doc): re-format tag example lines, mention ctags --list-kinds * v9.1.0646: imported function may not be found runtime(java): Document "g:java_space_errors" and "g:java_comment_strings" runtime(java): Cluster optional group definitions and their group links runtime(java): Tidy up the syntax file runtime(java): Tidy up the documentation for "ft-java-syntax" runtime(colors): update habamax scheme - tweak diff/search/todo colors runtime(nohlsearch): add missing loaded_hlsearch guard runtime(kivy): Updated maintainer info for syntax script Maintainers: Add maintainer for ondir ftplugin + syntax files runtime(netrw): removing trailing slash when copying files in same directory * v9.1.0645: wrong match when searching multi-byte char case-insensitive runtime(html): update syntax script to sync by 250 minlines by default * v9.1.0644: Unnecessary STRLEN( when applying mapping runtime(zip): Opening a remote zipfile don't work runtime(cuda): source c and cpp ftplugins * v9.1.0643: cursor may end up on invalid position * v9.1.0642: Check that mapping rhs starts with lhs fails if not simplified * v9.1.0641: OLE enabled in console version runtime(thrift): add ftplugin, indent and syntax scripts * v9.1.0640: Makefile can be improved * v9.1.0639: channel timeout may wrap around * v9.1.0638: E1510 may happen when formatting a message for smsg() * v9.1.0637: Style issues in MSVC Makefile - Update apparmor.vim to latest version (from AppArmor 4.0.2) - add support for "all" and "userns" rules, and new profile flags - Update to 9.1.0636: * 9.1.0636: filetype: ziggy files are not recognized * 9.1.0635: filetype: SuperHTML template files not recognized * 9.1.0634: Ctrl-P not working by default * 9.1.0633: Compilation warnings with `-Wunused-parameter` * 9.1.0632: MS-Windows: Compiler Warnings Add support for Files-Included in syntax script tweak documentation style a bit * 9.1.0631: wrong completion list displayed with non-existing dir + fuzzy completion * 9.1.0630: MS-Windows: build fails with VIMDLL and mzscheme * 9.1.0629: Rename of pum hl_group is incomplete * 9.1.0628: MinGW: coverage files are not cleaned up * 9.1.0627: MinGW: build-error when COVERAGE is enabled * 9.1.0626: Vim9: need more tests with null objects include initial filetype plugin * 9.1.0625: tests: test output all translated messages for all translations * 9.1.0624: ex command modifiers not found * 9.1.0623: Mingw: errors when trying to delete non-existing files * 9.1.0622: MS-Windows: mingw-build can be optimized * 9.1.0621: MS-Windows: startup code can be improved * 9.1.0620: Vim9: segfauls with null objects * 9.1.0619: tests: test_popup fails * 9.1.0618: cannot mark deprecated attributes in completion menu * 9.1.0617: Cursor moves beyond first line of folded end of buffer * 9.1.0616: filetype: Make syntax highlighting off for MS Makefiles * 9.1.0615: Unnecessary STRLEN() in make_percent_swname() Add single-line comment syntax Add syntax test for comments Update maintainer info * 9.1.0614: tests: screendump tests fail due to recent syntax changes * 9.1.0613: tests: termdebug test may fail and leave file around Update base-syntax, improve :set highlighting Optionally highlight the :: token for method references * 9.1.0612: filetype: deno.lock file not recognized Use delete() for deleting directory escape filename before trying to delete it * 9.1.0611: ambiguous mappings not correctly resolved with modifyOtherKeys correctly extract file from zip browser * 9.1.0610: filetype: OpenGL Shading Language files are not detected Fix endless recursion in netrw#Explore() * 9.1.0609: outdated comments in Makefile update syntax script Fix flow mapping key detection Remove orphaned YAML syntax dump files * 9.1.0608: Coverity warns about a few potential issues Update syntax script and remove syn sync * 9.1.0607: termdebug: uses inconsistent style * 9.1.0606: tests: generated files may cause failure in test_codestyle * 9.1.0605: internal error with fuzzy completion * 9.1.0604: popup_filter during Press Enter prompt seems to hang translation: Update Serbian messages translation * 9.1.0603: filetype: use correct extension for Dracula * 9.1.0602: filetype: Prolog detection can be improved fix more inconsistencies in assert function docs * 9.1.0601: Wrong cursor position with 'breakindent' when wide char doesn't fit Update base-syntax, improve :map highlighting * 9.1.0600: Unused function and unused error constants * 9.1.0599: Termdebug: still get E1023 when specifying arguments correct wrong comment options fix typo "a xterm" -> "an xterm" * 9.1.0598: fuzzy completion does not work with default completion * 9.1.0597: KeyInputPre cannot get the (unmapped typed) key * 9.1.0596: filetype: devscripts config files are not recognized gdb file/folder check is now performed only in CWD. quote filename arguments using double quotes update syntax to SDC-standard 2.1 minor updates. Cleanup :match and :loadkeymap syntax test files Update base-syntax, match types in Vim9 variable declarations * 9.1.0595: make errors out with the po Makefile * 9.1.0594: Unnecessary redraw when setting 'winfixbuf' using wrong highlight for UTF-8 include simple syntax plugin * 9.1.0593: filetype: Asymptote files are not recognized add recommended indent options to ftplugin add recommended indent options to ftplugin add recommended indent options to ftplugin * 9.1.0592: filetype: Mediawiki files are not recognized * 9.1.0591: filetype: *.wl files are not recognized * 9.1.0590: Vim9: crash when accessing getregionpos() return value 'cpoptions': Include "z" in the documented default * 9.1.0589: vi: d{motion} and cw work differently than expected update included colorschemes grammar fixes in options.txt - Add "Keywords" to gvim.desktop to make searching for gvim easier - Removed patches, as they're no longer required (refreshing them deleted their contents): * vim-7.3-help_tags.patch * vim-7.4-highlight_fstab.patch - Reorganise all applied patches in the spec file. - Update to 9.1.0588: * 9.1.0588: The maze program no longer compiles on newer clang runtime(typst): Add typst runtime files * 9.1.0587: tests: Test_gui_lowlevel_keyevent is still flaky * 9.1.0586: ocaml runtime files are outdated runtime(termdebug): fix a few issues * 9.1.0585: tests: test_cpoptions leaves swapfiles around * 9.1.0584: Warning about redeclaring f_id() non-static runtime(doc): Add hint how to load termdebug from vimrc runtime(doc): document global insert behavior * 9.1.0583: filetype: *.pdf_tex files are not recognized * 9.1.0582: Printed line doesn't overwrite colon when pressing Enter in Ex mode * 9.1.0581: Various lines are indented inconsistently * 9.1.0580: :lmap mapping for keypad key not applied when typed in Select mode * 9.1.0579: Ex command is still executed after giving E1247 * 9.1.0578: no tests for :Tohtml * 9.1.0577: Unnecessary checks for v:sizeoflong in test_put.vim * 9.1.0576: tests: still an issue with test_gettext_make * 9.1.0575: Wrong comments in alt_tabpage() * 9.1.0574: ex: wrong handling of commands after bar runtime(doc): add a note for netrw bug reports * 9.1.0573: ex: no implicit print for single addresses runtime(vim): make &indentexpr available from the outside * 9.1.0572: cannot specify tab page closing behaviour runtime(doc): remove obsolete Ex insert behavior * 9.1.0571: tests: Test_gui_lowlevel_keyevent is flaky runtime(logindefs): update syntax with new keywords * 9.1.0570: tests: test_gettext_make can be improved runtime(filetype): Fix Prolog file detection regex * 9.1.0569: fnamemodify() treats ".." and "../" differently runtime(mojo): include mojo ftplugin and indent script * 9.1.0568: Cannot expand paths from 'cdpath' setting * 9.1.0567: Cannot use relative paths as findfile() stop directories * 9.1.0566: Stop dir in findfile() doesn't work properly w/o trailing slash * 9.1.0565: Stop directory doesn't work properly in 'tags' * 9.1.0564: id() can be faster * 9.1.0563: Cannot process any Key event * 9.1.0562: tests: inconsistency in test_findfile.vim runtime(fstab): Add missing keywords to fstab syntax * 9.1.0561: netbeans: variable used un-initialized (Coverity) * 9.1.0560: bindtextdomain() does not indicate an error * 9.1.0559: translation of vim scripts can be improved * 9.1.0558: filetype: prolog detection can be improved * 9.1.0557: moving in the buffer list doesn't work as documented runtime(doc): fix inconsistencies in :h file-searching * 9.1.0556: :bwipe doesn't remove file from jumplist of other tabpages runtime(htmlangular): correct comment * 9.1.0555: filetype: angular ft detection is still problematic * 9.1.0554: :bw leaves jumplist and tagstack data around * 9.1.0553: filetype: *.mcmeta files are not recognized * 9.1.0552: No test for antlr4 filetype * 9.1.0551: filetype: htmlangular files are not properly detected * 9.1.0550: filetype: antlr4 files are not recognized * 9.1.0549: fuzzycollect regex based completion not working as expected runtime(doc): autocmd_add() accepts a list not a dict * 9.1.0548: it's not possible to get a unique id for some vars runtime(tmux): Update syntax script * 9.1.0547: No way to get the arity of a Vim function * 9.1.0546: vim-tiny fails on CTRL-X/CTRL-A runtime(hlsplaylist): include hlsplaylist ftplugin file runtime(doc): fix typo in :h ft-csv-syntax runtime(doc): Correct shell command to get $VIMRUNTIME into shell * 9.1.0545: MSVC conversion warning * 9.1.0544: filetype: ldapconf files are not recognized runtime(cmakecache): include cmakecache ftplugin file runtime(lex): include lex ftplugin file runtime(yacc): include yacc ftplugin file runtime(squirrel): include squirrel ftplugin file runtime(objcpp): include objcpp ftplugin file runtime(tf): include tf ftplugin file runtime(mysql): include mysql ftplugin file runtime(javacc): include javacc ftplugin file runtime(cabal): include cabal ftplugin file runtime(cuda): include CUDA ftplugin file runtime(editorconfig): include editorconfig ftplugin file runtime(kivy): update kivy syntax, include ftplugin runtime(syntax-tests): Stop generating redundant "*_* 99.dump" files * 9.1.0543: Behavior of CursorMovedC is strange runtime(vim): Update base-syntax, improve :match command highlighting * 9.1.0542: Vim9: confusing string() output for object functions * 9.1.0541: failing test with Vim configured without channel * 9.1.0540: Unused assignment in sign_define_cmd() runtime(doc): add page-scrolling keys to index.txt runtime(doc): add reference to xterm-focus-event from FocusGained/Lost * 9.1.0539: Not enough tests for what v9.1.0535 fixed runtime(doc): clarify how to re-init csv syntax file * 9.1.0538: not possible to assign priority when defining a sign * 9.1.0537: signed number detection for CTRL-X/A can be improved * 9.1.0536: filetype: zone files are not recognized * 9.1.0535: newline escape wrong in ex mode runtime(man): honor cmd modifiers before `g:ft_man_open_mode` runtime(man): use `nnoremap` to map to Ex commands * 9.1.0534: completion wrong with fuzzy when cycling back to original runtime(syntax-tests): Abort and report failed cursor progress runtime(syntax-tests): Introduce self tests for screen dumping runtime(syntax-tests): Clear and redraw the ruler line with the shell info runtime(syntax-tests): Allow for folded and wrapped lines in syntax test files * 9.1.0533: Vim9: need more tests for nested objects equality CI: Pre-v* 9.0.0110 versions generate bogus documentation tag entries runtime(doc): Remove wrong help tag CTRL-SHIFT-CR * 9.1.0532: filetype: Cedar files not recognized runtime(doc): document further keys that scroll page up/down * 9.1.0531: resource leak in mch_get_random() runtime(tutor): Fix wrong spanish translation runtime(netrw): fix remaining case of register clobber * 9.1.0530: xxd: MSVC warning about non-ASCII character * 9.1.0529: silent! causes following try/catch to not work runtime(rust): use shiftwidth() in indent script * 9.1.0528: spell completion message still wrong in translations * 9.1.0527: inconsistent parameter in Makefiles for Vim executable * 9.1.0526: Unwanted cursor movement with pagescroll at start of buffer runtime(doc): mention $XDG_CONFIG_HOME instead of $HOME/.config * 9.1.0525: Right release selects immediately when pum is truncated. * 9.1.0524: the recursive parameter in the *_equal functions can be removed runtime(termdebug): Add Deprecation warnings * 9.1.0523: Vim9: cannot downcast an object * 9.1.0522: Vim9: string(object) hangs for recursive references * 9.1.0521: if_py: _PyObject_CallFunction_SizeT is dropped in Python 3.13 * 9.1.0520: Vim9: incorrect type checking for modifying lists runtime(manpager): avoid readonly prompt * 9.1.0519: MS-Windows: libvterm compilation can be optimized * 9.1.0518: initialize the random buffer can be improved * 9.1.0517: MS-Windows: too long lines in Make_mvc.mak runtime(terraform): Add filetype plugin for terraform runtime(dockerfile): enable spellchecking of comments in syntax script runtime(doc): rename variable for pandoc markdown support runtime(doc): In builtin overview use {buf} as param for appendbufline/setbufline runtime(doc): clarify, that register 1-* 9 will always be shifted runtime(netrw): save and restore register 0-* 9, a and unnamed runtime(termdebug): Refactored StartDebug_term and EndDebug functions runtime(java): Compose "g:java_highlight_signature" and "g:java_highlight_functions" * 9.1.0516: need more tests for nested dicts and list comparision * 9.1.0515: Vim9: segfault in object_equal() * 9.1.0514: Vim9: issue with comparing objects recursively runtime(termdebug): Change some variables to Enums runtime(vim): Update base-syntax, fix function tail comments * 9.1.0513: Vim9: segfault with object comparison - Update to 9.1.0512: * Mode message for spell completion doesn't match allowed keys * CursorMovedC triggered wrongly with setcmdpos() * update runtime files * CI: test_gettext fails on MacOS14 + MSVC Win * not possible to translate Vim script messages * termdebug plugin can be further improved * add gomod filetype plugin * hard to detect cursor movement in the command line * Optionally highlight parameterised types * filetype: .envrc & .prettierignore not recognized * filetype: Faust files are not recognized * inner-tag textobject confused about ">" in attributes * cannot use fuzzy keyword completion * Remove the group exclusion list from @javaTop * wrong return type for execute() function * MS-Windows: too much legacy code * too complicated mapping restore in termdebug * simplify mapping * cannot switch buffer in a popup * MS-Windows: doesn't handle symlinks properly * getcmdcompltype() interferes with cmdline completion * termdebug can be further improved * update htmldjango detection * Improve Turkish documentation * include a simple csv filetype and syntax plugin * include the the simple nohlsearch package * matched text is highlighted case-sensitively * Matched text isn't highlighted in cmdline pum * Fix typos in several documents * clarify when text properties are cleared * improve the vim-shebang example * revert unintended formatting changes for termdebug * Add a config variable for commonly used compiler options * Wrong matched text highlighted in pum with 'rightleft' * bump length of character references in syntax script * properly check mapping variables using null_dict * fix KdlIndent and kdlComment in indent script * Test for patch 9.1.0489 doesn't fail without the fix * Fold multi-line comments with the syntax kind of &fdm * using wrong type for PlaceSign() * filetype: Vim-script files not detected by shebang line * revert unintended change to zip#Write() * add another tag for vim-shebang feature * Cmdline pum doesn't work properly with 'rightleft' * minor style problems with patch 9.1.0487 * default completion may break with fuzzy * Wrong padding for pum "kind" with 'rightleft' * Update base-syntax, match shebang lines * MS-Windows: handle files with spaces properly * Restore HTML syntax file tests * completed item not update on fuzzy completion * filetype: Snakemake files are not recognized * make TermDebugSendCommand() a global function again * close all buffers in the same way * Matched text shouldn't be highlighted in "kind" and "menu" * fix wrong helptag for :defer * Update base-syntax, match :sleep arg * include Georgian keymap * Sorting of completeopt+=fuzzy is not stable * correctly test for windows in NetrwGlob() * glob() on windows fails with [] in directory name * rewrite mkdir() doc and simplify {flags} meaning * glob() not sufficiently tested * update return type for job_info() * termdebug plugin needs more love * correct return types for job_start() and job_status() * Update base-syntax, match :catch and :throw args * Include element values in non-marker annotations * Vim9: term_getjob() throws an exception on error * fuzzy string matching executed when not needed * fuzzy_match_str_with_pos() does unnecessary list operations * restore description of "$" in col() and virtcol() * deduplicate getpos(), line(), col(), virtcol() * Update g:vimsyn_comment_strings dump file tests * Use string interpolation instead of string concat * potential deref of NULL pointer in fuzzy_match_str_with_pos * block_editing errors out when using * Update base-syntax, configurable comment string highlighting * fix typos in syntax.txt * Cannot see matched text in popup menu * Update base-syntax, match multiline continued comments * clarify documentation for "v" position at line() * cmod_split modifier is always reset in term_start() * remove line-continuation characters * use shiftwidth() instead of &tabstop in indent script * Remove orphaned screen dump files * include syntax, indent and ftplugin files * CI: Test_ColonEight() fails on github runners * add missing Enabled field in syntax script * basic svelte ftplugin file * term_start() does not clear vertical modifier * fix mousemodel restoration by comparing against null_string * Added definitions of Vim scripts and plugins * Exclude lambda expressions from _when_ _switch-case_ label clauses * Fix saved_mousemodel check * Inconsistencies between functions for option flags * Crash when using autocmd_get() after removing event inside autocmd * Fix small style issues * add return type info for Vim function descriptions * Update Italian Vim manpage * disable the q mapping * Change 'cms' for C++ to '// %s' * fix type mismatch error * Fix wrong email address * convert termdebug plugin to Vim9 script - Update to 9.1.0470: * tests Test_ColonEight_MultiByte() fails sporadically * Cannot have buffer-local value for 'completeopt' * GvimExt does not consult HKEY_CURRENT_USER * typos in some comments * runtime(vim): Update base-syntax, allow whitespace before :substitute pattern * Missing comments for fuzzy completion * runtime(man): update Vim manpage * runtime(comment): clarify the usage of 'commentstring' option value * runtime(doc): clarify how fuzzy 'completeopt' should work * runtime(netrw): prevent accidental data loss * missing filecopy() function * no whitespace padding in commentstring option in ftplugins * no fuzzy-matching support for insert-completion * eval5() and eval7 are too complex * too many strlen() calls in drawline.c * filetype lintstagedrc files are not recognized * Vim9 import autoload does not work with symlink * Coverity complains about division by zero * tests test_gui fails on Wayland * Left shift is incorrect with vartabstop and shiftwidth=0 * runtime(doc): clarify 'shortmess' flag "S" * MS-Windows compiler warning for size_t to int conversion * runtime(doc): include some vim9 script examples in the help * minor issues in test_filetype with rasi test * filetype rasi files are not recognized * runtime(java): Improve the matching of lambda expressions * Configure checks for libelf unnecessarily * No test for escaping '<' with shellescape() * check.vim complains about overlong comment lines * translation(it): Update Italian translation * evalc. code too complex * MS-Windows Compiler warnings - Update to 9.1.0448: * compiler warning in eval.c * remove remaining css code * Add ft_hare.txt to Reference Manual TOC * re-generate vim syntax from generator * fix syntax vim bug * completion may be wrong when deleting all chars * getregionpos() inconsistent for partly-selected multibyte char * fix highlighting nested and escaped quotes in string props * remove the indent plugin since it has too many issues * update Debian runtime files * Coverity warning after 9.1.0440 * Not enough tests for getregion() with multibyte chars * Can't use blockwise selection with width for getregion() * update outdated syntax files * fix floating_modifier highlight * hare runtime files outdated * getregionpos() can't properly indicate positions beyond eol * function get_lval() is too long * Cannot filter the history * Wrong Ex command executed when :g uses '?' as delimiter * support floating_modifier none; revert broken highlighting * Motif requires non-const char pointer for XPM data * Crash when using '?' as separator for :s * filetype: cygport files are not recognized * make errors trying to access autoload/zig * Wrong yanking with exclusive selection and ve=all * add missing help tags file * Ancient XPM preprocessor hack may cause build errors * include basic rescript ftplugin file * eval.c is too long * getregionpos() doesn't handle one char selection * check for gdb file/dir before using as buffer name * refactor zig ftplugin, remove auto format * Coverity complains about eval.c refactor * Tag guessing leaves wrong search history with very short names * some issues with termdebug mapping test * update matchit plugin to v1.20 * too many strlen() calls in search.c * set commentstring option * update vb indent plugin as vim9script * filetype: purescript files are not recognized * filetype: slint files are not recognized * basic nim ftplugin file for comments * Add Arduino ftplugin and indent files * include basic typst ftplugin file * include basic prisma ftplugin file * include basic v ftplugin for comment support * getregionpos() wrong with blockwise mode and multibyte * function echo_string_core() is too long * hyprlang files are not recognized * add basic dart ftplugin file * basic ftplugin file for graphql * mention comment plugin at :h 'commentstring' * set commentstring for sql files in ftplugin * :browse oldfiles prompts even with single entry * eval.c not sufficiently tested * clarify why E195 is returned * clarify temporary file clean up * fix :NoMatchParen not working * Cannot move to previous/next rare word * add basic ftplugin file for sshdconfig * if_py: find_module has been removed in Python 3.12.0a7 * some screen dump tests can be improved * Some functions are not tested * clarify instal instructions for comment package * Unable to leave long line with 'smoothscroll' and 'scrolloff' * fix typo in vim9script help file * Remove trailing spaces * clarify {special} argument for shellescape() - update to 9.1.0413 * smoothscroll may cause infinite loop * add missing entries for the keys CTRL-W g and * update vi_diff.txt: add default value for 'flash' * typo in regexp_bt.c in DEBUG code * allow indented commands * Fix wrong define regex in ftplugin * Filter out non-Latin-1 characters for syntax tests * prefer scp over pscp * fix typo in usr_52.txt * too long functions in eval.c * warning about uninitialized variable * too many strlen() calls in the regexp engine * E16 fix, async keyword support for define * Stuck with long line and half-page scrolling * Divide by zero with getmousepos() and 'smoothscroll' * update and remove some invalid links * update translation of xxd manpage * Recursively delete directories by default with netrw delete command * Strive to remain compatible for at least Vim 7.0 * tests: xxd buffer overflow fails on 32-bit * Stop handpicking syntax groups for @javaTop * [security] xxd: buffer-overflow with specific flags * Vim9: not able to import file from start dir * filetype: mdd files detected as zsh filetype * filetype: zsh module files are not recognized * Remove hardcoded private.ppk logic from netrw * Vim9: confusing error message for unknown type * block_editing errors out when using del * add new items to scripts section in syntax plugin * Vim9: imported vars are not properly type checked * Wrong display with 'smoothscroll' when changing quickfix list * filetype: jj files are not recognized * getregionpos() may leak memory on error * The CODEOWNERS File is not useful * Remove and cleanup Win9x legacy from netrw * add MsgArea to 'highlight' option description * Cannot get a list of positions describing a region * Fix digit separator in syntax script for octals and floats * Update link to Wikipedia Vi page * clear $MANPAGER in ftplugin before shelling out * Fix typos in help documents * 'viewdir' not respecting $XDG_CONFIG_HOME * tests: Vim9 debug tests may be flaky * correct getscriptinfo() example * Vim9: could improve testing * test_sound fails on macos-12 * update Serbian menu * update Slovak menu * update Slovenian menu * update Portuguese menu * update Dutch menu * update Korean menu * update Icelandic menu * update Czech menu * update Afrikaans menu * update German menu * filetype: inko files are not recognized * filetype: templ files are not recognized * cursor() and getregion() don't handle v:maxcol well * Vim9: null value tests not sufficient * update Catalan menu * filetype: stylus files not recognized * update spanish menu localization * regenerate helptags * Vim9: crash with null_class and null_object * Add tags about lazyloading of menu * tests: vt420 terminfo entry may not be found * filetype: .out files recognized as tex files * filetype: Kbuild files are not recognized * cbuffer and similar commands don't accept a range * Improve the recognition of the "indent" method declarations * Fix a typo in usr_30.txt * remove undefined var s:save_cpoptions and add include setting * missing setlocal in indent plugin * Calculating line height for unnecessary amount of lines * improve syntax file performance * There are a few typos * Vim9: no comments allowed after class vars * CI: remove trailing white space in documentation * Formatting text wrong when 'breakindent' is set * Add oracular (24.10) as Ubuntu release name * Vim9: Trailing commands after class/enum keywords ignored * tests: 1-second delay after Test_BufEnter_botline() * update helptags for jq syntax * include syntax, ftplugin and compiler plugin * fix typo synconcealend -> synconcealed * include a simple comment toggling plugin * wrong botline in BufEnter * clarify syntax vs matching mechanism * fix undefined variable in indent plugin * ops.c code uses too many strlen() calls * Calling CLEAR_FIELD() on the same struct twice * Vim9: compile_def_function() still too long * Update Serbian messages * clarify the effect of setting the shell to powershell * Improve the recognition of the "style" method declarations * Vim9: problem when importing autoloaded scripts * compile_def_function is too long * filetype: ondir files are not recognized * Crash when typing many keys with D- modifier * tests: test_vim9_builtin is a bit slow * update documentation * change the download URL of "libsodium" * tests: test_winfixbuf is a bit slow * Add filetype, syntax and indent plugin for Astro * expanding rc config files does not work well * Vim9: vim9type.c is too complicated * Vim9: does not handle autoloaded variables well * minor spell fix in starting.txt * wrong drawing in GUI with setcellwidth() * Add include and suffixesadd * Page scrolling should place cursor at window boundaries * align command line table * minor fixes to starting.txt * fix comment definition in filetype plugin * filetype: flake.lock files are not recognized * runtime(uci): No support for uci file types * Support "g:ftplugin_java_source_path" with archived files * tests: Test_autoload_import_relative_compiled fails on Windows * Finding cmd modifiers and cmdline-specials is inefficient * No test that completing a partial mapping clears 'showcmd' * tests: test_vim9_dissamble may fail * Vim9: need static type for typealias * X11 does not ignore smooth scroll event * A few typos in test_xdg when testing gvimrc * Patch v9.1.0338 fixed sourcing a script with import * Problem: gvimrc not sourced from XDG_CONFIG_HOME * Cursor wrong after using setcellwidth() in terminal * 'showcmd' wrong for partial mapping with multibyte * tests: test_taglist fails when 'helplang' contains non-english * Problem: a few memory leaks are found * Problem: Error with matchaddpos() and empty list * tests: xdg test uses screen dumps * Vim9: import through symlinks not correctly handled * Missing entry for XDG vimrc file in :version * tests: typo in test_xdg * runtime(i3config/swayconfig): update syntax scripts * document pandoc compiler and enable configuring arguments * String interpolation fails for List type * No test for highlight behavior with 'ambiwidth' * tests: test_xdg fails on the appimage repo * tests: some assert_equal() calls have wrong order of args * make install does not install all files * runtime(doc): fix typos in starting.txt- Updated to version 9.1 with patch level 0330, fixes the following problems * Fixing bsc#1220763 - vim gets Segmentation fault after updating to version 9.1.0111-150500.20.9.1 - refreshed vim-7.3-filetype_spec.patch - refreshed vim-7.3-filetype_ftl.patch - Update spec.skeleton to use autosetup in place of setup macro. - for the complete list of changes see https://github.com/vim/vim/compare/v9.1.0111...v9.1.0330- Updated to version 9.1 with patch level 0111, fixes the following security problems * Fixing bsc#1217316 (CVE-2023-48231) - VUL-0: CVE-2023-48231: vim: Use-After-Free in win_close() * Fixing bsc#1217320 (CVE-2023-48232) - VUL-0: CVE-2023-48232: vim: Floating point Exception in adjust_plines_for_skipcol() * Fixing bsc#1217321 (CVE-2023-48233) - VUL-0: CVE-2023-48233: vim: overflow with count for :s command * Fixing bsc#1217324 (CVE-2023-48234) - VUL-0: CVE-2023-48234: vim: overflow in nv_z_get_count * Fixing bsc#1217326 (CVE-2023-48235) - VUL-0: CVE-2023-48235: vim: overflow in ex address parsing * Fixing bsc#1217329 (CVE-2023-48236) - VUL-0: CVE-2023-48236: vim: overflow in get_number * Fixing bsc#1217330 (CVE-2023-48237) - VUL-0: CVE-2023-48237: vim: overflow in shift_line * Fixing bsc#1217432 (CVE-2023-48706) - VUL-0: CVE-2023-48706: vim: heap-use-after-free in ex_substitute * Fixing bsc#1219581 (CVE-2024-22667) - VUL-0: CVE-2024-22667: vim: stack-based buffer overflow in did_set_langmap function in map.c * Fixing bsc#1215005 (CVE-2023-4750) - VUL-0: CVE-2023-4750: vim: Heap use-after-free in function bt_quickfix - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.2103...v9.1.0111- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.2103- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxdh02-armsrv2 1750246409  9.1.1406-150500.20.27.19.1.1406-150500.20.27.19.1.1406-150500.20.27.19.1.1406-150500.20.27.19.1.1406-150500.20.27.19.1.1406-150500.20.27.19.1.1406-150500.20.27.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:39326/SUSE_SLE-15-SP5_Update/380f8d491115cb40d126d094719a1705-vim.SUSE_SLE-15-SP5_Updatedrpmxz5aarch64-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.1406-150500.20.27.1.aarch64/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.1406-150500.20.27.1.aarch64/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, for GNU/Linux 3.7.0, BuildID[sha1]=db988afcb1dfc1616c6341d93e2b107e6c9a4574, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image##RR R$RRRR"R R&RRRRRRRRRRRRRR RRR#R%R R RRR R!RRPPP P PP PPPPPPPPPP P T:h㲞 ˛utf-87ed6e0085a1426b99792fbab46e1bb3461e9bc8d668547a4b121c3e3f3028b44?7zXZ !t/9f]"k%F #20n'釸頒PĆ1D옑T 2  ^IOPb|b!r^z|kZk;|pwЊiZ^d~W`yǖ?t$B˴MSϰ0?'EJY):Րz*B!Lm7:\t[{h!]L^gv`NnoCϔ..n`_qP }g<::ӵ1 gsZ|o5(-CWd:_1`1Nd;wL{5V:1ŒШ9 #aaA']qOpeSᾴ«yJ/M!$[HY_( }=WCE4JY٬G@+0kX~#M"uɞ_Ժud*N]`IZ d2)j}Mtn$hw9~N4F5MAȄ;pD-#؊0fM^ <["nH1dDYKl\9˚,H 'B G %nL!Z~y}UɱЈM7š?͎ n\tQ>X=hZ5ҩ~vA=:Guc/6Sڵ{%>F^ 6ZFU^Ҵ-7=R#&7@y{,{$2h.F4GĪA^@D |vy; $ߜЭ2囲IDffԷW@;I#{T]Aؑ 1DԨܗEJbJY.x% O3qӗv p23mz N`\* BAލ)}]䅿'҂:uߐ5!@mJ}@XlN ?6xEp9Z*+GLsc:erfL)/h^?MQo2Cz&c8Kvu!Dx<&JWym嵲(k=_})94ʘM}lbwzUY,5|h? `!=%c)jiT د8s:H-,pwc̋#Vw-HϦ NDN@p,1`/BNxKun{=^V h0SUkSYEIy)_VF} y.,gwP7k?aj3g+&c ib*Bo@bJT3T7eW,Miqe0hNY NrjRB|=K孵D:ꭙ|wB@wd0hzۍcz'eaؠ-B&#Ƃ?*iȧRaNe6pe{-M%֬7d0VaɭN&8*$cR_GCU^e!0=_IT#aRT1 G.L070anD^A"{ u fNFhkJB3EQ5dWgwzܢu#ۮCw@^f`oYDq[Vth"(sܛWJLJG5y;YMy4a!,m z!HK3}GP̯'X']Qj_?OiEYur +)cT?MTW@^3u!0ãEvw cg݇2R吋\54 hQd΋$aLCZg ~Q~UǵD/}@涬P+sQNNcUt^mˊRkJu#J .c~Ao!2Ո@>L00p|[}_W50`LQUtbY52 s5X )-7ќ ɩ FWsdŇL8|ϥCQCZ#kԤ֜-'<ږaYN1ƙzrw,O%σ3Lf5=#> {## rqrr.Q p#~cpF0[X.}DRAQ"u>:g4V)'%NBTy#c Е?& ;OdhUzGS `z(k^/kGGt*whG2wQs31*{a[xqia0Sd(Fj͊G\㻴*F5:f@s(۪+ 4%JRQ>_ʳqX) y!㷚:>Q 8S\=녑(KUb9EMP?jѮia伪_OH4'[ X?a ӪwOf! S0jM3xFEF-}#OacmU.Z>xA[ex;;JY9XN$*`j*l)FñU$J;df`yQZ[ '3/{\KK؏iܯGF;UveBS-3fxIXMr§ d$!P{lFXἨ( tgyPc)ؾf wedqCfnT"$ c4|&^x6(_}R Ӊ| 4q)ȹY9)ʐx)egBt<ݯH5(Sa|4t:lj//b:3ϺclB @RѸҠp:#>a *GMm2p*k"!/``;{Ki4jU9$y&A}kƍMX4J{Ny~u("%DNo_x^AE fz4ξ' ܴq pcz*n`6ʸ j$qFRpGڤ;`-iu/yOmf/*!ÕHH(ޮ Vh%<\Ad%'rsI3?4_D.stӖ=Um".EG_7yOrg-km諷PԿlw)b2"`(c5M?k1ٽ,N|\~aٜƇ`[{|q[{ݼ^5j6n*'d\ t=]l{L }AųU+ TɪrtimbdGdNb}\ayW0~ӂcP4٦A5ۋ p4q巎eo>3ISG&{{}V%snRNn .WCZ)c}FÓ|ߎrtF 0l] &w`޵~Ѫ|an|+y}rCJ\%USأ~5vhiqkU{PQzxh1R;0h'E30;O lpwPv}ܣ@]L}2Y-UtFاm`)H-^hm>)ddU>-I>vػ{BKh 0_cڃT>%gcy>2b3 WXЮn +@%t2/Xn>#2U%LfjL[j^pb2lڶ$M$k4C˝9L#?V(#w#'#_ %=(E#ji0.GR5=a<Y(?^w;}y#`QM-8cd`؄'օ9UmRj ׳ B:(9R*w g|//܆q5N#VͼN?SQқBo< 3^^rqJRjO# b4 8&gYWoQiZ8wl1.+F{J`@a\k(R/$UgΜ`5p3U{/E@^{X )ӹ}'X̂ɤR~*sLe4[j-I>Z/z31ic5}΃wGdȄ"ʵ[S%1biK\e~2v$*ȺZA{(3L?r%r L8ɇOsXe5Ai˩=W@f/Ǖ' X=ԂSCRz '4?By[+s Y>ǞUN1p V[5Y.]MPa&Ns=#6N?O7!B=ox&^dxǽ "4Ml\B`IJ(?*c`;OoˌNGw,"y ;1JIR#ϯ&=ߤױ&iH)=˗(J%4o\uk`"o O{ -շ`t ZJ;7B |PF[&?I0 khmB?^^1)Nia5H*:HvU?zZytd_8Ppp A"v~=Y孱e5~;ޤT-9mX U/1$ޒG\#fBelo+򗏛d@Az١55hefޤ[mUz]A0@=B0 m0?1JG*3ߎr|}FĄn6l!&HW|Iٽf. e Au5=2*~ ҡOk-jkk/'hcq qh"xh{dhW滦aq-}rε %kZ)3-ԢX&sO.ș1AFY3DְfMWGs,w>p5Z z)#ef S=oOڮ3F{J PyJ~_|T{rqpqJE˙OvV! ߯ͻ xPl > )Z'd?촜E?/ Yo}JgJ8w 1öFiPgW)we{^Qi{49@~AqM*$wR?#/% "&u-/&k |46OXg)mz[T3٢Ixkuu Sd?aQb Cg|[J":c>Ä\j"n_ i^7n^4! JgQSj8Fns|=EMאjNNBWӴa#+% `dtͪEX7}$(&{<IJ[fٞ E`hp]5l؂NwWiې?k'?UubC%ۗ`>G_ȴUo᪉U#x>_]wܙs\LL;bEg G!9K1Įҍ S,:vK}+тtCO(ab ! $G6"`0 }Qi<9r-E-$ki:EL?sQ43Ix^(^ I΄Q'pGJm-]̾\h|64:XG΀K٥%@E[.D=o-[ !\ Λ'/r;zJ5>BdNX 8Vpٚh{0 rrE=fS?ݬV=&c7 #4i G8= $5; QgaÒ$pR'VhY qR^ Y߁w7CM6 h+o|Q(]_ۀer=:}p aʵa~0stu3X-2̶%zPwor (:ܩ YQ 8MlDV.#?G_FQ@yߏ'% 7e~ \v3b!t.ze'A}[3t抪P.;ϯ.ٟpjW$^NnqlU}PخGmHiC bbSBNxog\IkkN£M: sD)pWa)7{;PTM‹/ 𢩽v- D<ؼmFh؇{f+yo&!(,J!7k0dyI6Nìg{uY,'~YNϞ =}+ID-' ;qyяm;UWByj"c 6L(st1ѲA걣"aX#P$rU2.ΘǵK"0d%Vj(f~ 4I**eo&(1v@sZT2q8!8ݝbiQ iu|bjĶs+a!I4IV1F`Ӌ Q,Gg nTT |"%{Yc\4oVQ}STrr>1jl,ѧY,!zv/{;`HSɛeK̓\LFw)vعG֪i]Jpc(dnIJ [g{.1_]_CH b0'?S:H R,.A?@{]Vn[iVǟMy8nBelpαpJ ?@vߙl:I>+!~T 첪%u!p ]H t^b4h3pohCD?( 2JY*kC?тtdS,Uݸ"XbOG@ wנ&_|1ci$aZZpa[ tt*=aP["(%C__nvoj@<,BWao۫/Ս&?;X~sdrRX^j\f.Rθ+ǣUs?Ԏ$Qɸr{+qȝϗ|ep%H z:6G73`5;5˫U }4%6 + &tN2&_}ثG,4ɸUҠ̨r1b|cTamk5k<4QPt8 4ӦŠz=\G cG܇a~,iA0BSAE3b9 (ğ&G2\R@gQ[_2)< Lux74XjAsYqa(yc|&k 1EȄ j?[袤r&g*Nz&}/cIdVjxn=:!UblңOvvBr ~d$*aoHhf)-*zNro{?M3w` ~Pڰ_X8+JWMG3J#pVn7yL_iJ<'7miS:!˹k w9R&Iyæj$z~:Q`/Åy{o)e` T3-:.P iy"%ᘟ<0I%nQ*4H$ߋ\ϳ.YF(Q=ZB%^J3eMt=8pCO0X@L*$HM7bljOڡL|Tϸʬb]A|S6}]n{_,TxNVNfVQct'=Ùg܀|C/~S|H!*!D\-7pΟ.`R$.-JBm){"+j_HTUBx:ٸuYjR/GDH <#v(ntJqAl":Fm{`:&t_`UQ>%Go1WUa.sG&;jK5^:l~<P8A܀/;ٴwzּ0} nVVu}y;H겨|ŊcBZ8v2cd,A&:80=HUDM"?kkwJۻ7պIi鏎05' m$wQ%=AiL@*lJAH萱}. jz2'pFM@p``eԐG =w ;ކbV_6ٞGڨ4[͚Gy$Ŕ]S{F% 5;mv˷2U|^2̋b7d[} IhsG͟O`8?(T&l>/{d}̈́- T59?t5@KWK X#}~Z006,rGeR6.kDs(I\*E2 WR龽P/zGV":Moڧ'yGLΊ[@>[;醷 [>1#0OzjA?HxN"x;dر^O k.wT3,$ȴc]<^T$0 *5aZo83P'QC 6 bwUͫ F::,+3%5G4J]Iohߡisg{ՠfvkG /A Ƚ|ȸmA񣏦l+\? -Ǡ`#lZ Wf,B8#ȇ~l㪢&#V'8P<TֵJovn8Wk)W<ǞF4/Ä.R<阁]h';G2ųբy.ve> g_R |#ʱ[| 1¬)X|g)dlSCA!}{RYâݵ 0=s?y$:t-S1RE8F7PˋƝxV&7|afV8b~ZsMoҏhbT386Kpf75Xz01ϒV~9Ў.|[KQJɎ#a+JEiAہqwX5c8ɴ'8/ʰ H]GQ[g xd+'R:ut#o"o򦻆5;&=%hOUUƚTI*Mgu13rj7KVlTm2PlIgSrKY d \݀z0ke;zZ?y=׎!YbHB2Q杰 >#ϖ Oβ\A] 2]4&,ᐾݿ= up`<\r "F ;O`T}9 ^>-E-镺Gs{Ozx k(Ci2{&*yvHϿw=`Fv׎)@jTXF UǝJ?ɥ$$˚cȃ}#MmRme-b /  eD0 , d;]~z-gNAo }Q@3q82U˃l2D!$/9U!Ѝ|ff*|rJd'oR9l(?8B胲X; BV46ṇH0ܡhjBKq,8>ijEwu,0:Z&B96+ s,a! Ԏ[D} y.S%' >gv]wQ!cGTDEcNKKSxBpUc=FʨlbA"1$Biu4]2GvM[vW6>VCOk(>ۢ`1 7'+E-.@3+duzR#$u,3?tZ0@Mxz}(>*ꅓrp}.>HqEuU-Ύ3+^.I^Q85as^24/hv z)ML-;&t*62F9[329򷻀R%ié{SkM Ҭp͆Q;ct>&o(u+(0s&.%xץ:P6aؾn+x+{5j y2xc')dSVAR(cȨ7npd\5rhl3W>WWK}7p֊φR8\st:/`P_H _YC7|4tntvG - +hE6ɣ 0!L/#@qz1/`<Izxh(-8I ү %+ӐV?=OnytioN>#Х&*2]<񠿳eLi14|%4LeN_zMml<뿉 iS4G>z,"8Uz-\‰8|zظF\cL6R,]}sb[/AU|ûG؁yPV-5yw*IRn֞6k<20l)c9qGn'Aэ%@oi9x$Bz;!CPap}e#c}M^֙ p)&6'I +B]`,J~ƒ)euJUIr&(; wqO 9PP<bXhyY_8]*k=xY%o}GL:I>YX&CwtEJm7|lF>Rg#zRg:o%`6`,a8HTn@(Nؗ` ݭ#Z>SEpՃPFK|e kszxmo 8=y?=G"~]5bAC/z:PӂZCӤts0kn;1gO2_FV@ben ;])Q#Uդlt(Q{yk$8m^.e Lr}odl8NDAr%I_A鑳CR[-D!yUKȀK0a{S8HN4t)L@lj2dYH*/'bg2PlZJ>!-*a/#Ο|uo}!]ؽg1:ikҷX*\H݌^UȖT29=m,BױL-{3"l5ySSan3o6D[ӧΛa'1:3Getҟʹ䳭%ƣ>֗U&f(@K,i; c@Ն5~ZWHu:\J.M Dzͺ;"}zB4̴1l{Ϡ7$Κu_W-I)ʆ aWH¬Eh E9/AG ,1)=(XkF;C`Sk>k$ =[ϽS1e_3EkgP S=}#k.V}_*9zZrVj455 :"4גVHBEU{օ>"e?@4;< vܤs vlP G4K()"܀vcgK5`pŀ,.q> y?>Pg/Y7zb#Dky\?%0j"Y_NQ#4z]0A~3SŔ EtzЃPک)b3Nq1-)_ҖӛٷdC)ʹp#lr|m;e|TXTGɄI^4y4X"IuR[ņG'kNFg[K =+xmc$aNӹiIioIؗ@[,JZo4MEbkyErPy~uh"E7 @-I݌K+4nVbR [ʝ6$<sנaDuZ%4SJMa-P/)|g|DB=ڍ< }-懻jiWY^}m mu;z:5yBMi v,20U,ە;n b蹱m)GuΘW˸r&sD25r0sf\ c$ɐyběa6Җ҄H=Zj:6ɪ}~t8bo ZQ1133{LY+kiFd,!ǁiiɷ %d 7}A6p-`lcE{uch,)ptA[r1ކtER0~" ַ u@>G.2wvbCņ|" vA7kP =&i#;I>kCڣн6յtЕ-&gR;y_'{)lΛw3~pj1զ^OrUNdmqq߱aCi{I ^tu{ I;76(˝*?sǕv%-0MzTPƃqy 5u3}GQNU,΃t6?ೝ~} 8:-_LhNBc#zhh''e0t z.ѰS$B4}U܀<Xu8fjL0xR31 hXs*QX{cVMw~d4.sGO8:vDE3;;{.-~!Zٱe\]D}1'ع3J&Ahӟ%(fd.h5&ĖA,AY鏨 &ߵELx|HH]{,xH8>$=K dd~^?O:6+ic@JBĩXx Jhɑ)>~7jTfszX* k"ʵ@7#:&k@݀o@-Zk(dl62)64{F6sw;h-4"[=S8#? z}8 i[r]b!RYNaz9@A'sh~\N3s]]G`]^onCHAf^MYnH8lN+뉭.F|"rIDJ@hQJHltNQȹ-/jO{ G> OpCcK8 7ˏP|k|]Ovr+\D29ɡWy]qJKYqCSK+K/k{ڠ%FsZ%v UO3,6,#\`lowN g1ͷh(i,ӒA3ٕp lcf 嗁 s[q-2WIqri5!3mO@^8SW8#J4FsK?ZgS+UC`jnvu\PF4Rn.g%5yrf!7b!)zYX>byF ј rohEV/򺩋-ĜnBH.ne̦Ǭp(Ũ>0 o`7}>zr3ށQ Q>E0»k4A11v#GoJ q<+xkᘊ!6統DZNsmr#5,ZRE: h"Ӿfyq]SvZ@%_Od`m8ٛqzhP0QoJ!OJW<(UBnM ?X9.}]4۴.7Z[\a's+,<|@~Y9* Se54&-g*E:&UJыumY1m^ErOaH4?'MaQ@Wz$R^~_,n…iԍ+m2<9:oZwr1Z9̢f6aؿEq @sN6/r<©|f`["΢Rl~(N c)^ 2'zE7Y8QG24lB#B1'ܪ2%L"E0q鳛ǖp'1c:M?^~p`t? 40/rLk;|b>l\O `R̸dT0y08*-c>R%G>fk%7$z-H"ZA Q2U>_~iNƶx1S٥[x @ġNDH r4x菬ha⢝I)ۀ^ vmS3:9 J 'Hi4ĵQ(C~ (jpxU5640gs.3Z*0\oF*b2=(hS;IkM1HUZ50 "=}jKXb mJD(xrݥ[%ExsaKed%̽-dm%6^Zl,`Ǫ~l9- tؽ9);hOKPp{3/Q*S\jYvb}A NAgp,2dvmFӼ]K&O[y0p(9 r_cP`Ri"C4y\~P]C1xdXƘJpQLTe;::fLyjȵ!1KDhSRmӹ?e}!I {L.}C >5ڶds~q/@k, PAs5U 崢pc$'Ib*Ck[v(rphmbB?;5.!1oƱjwb J,-o =lhEiBanjܾu{ >;ԙ:CIc7>on??^[I[I}.(X aلlk@4uN}MF[Bj^4 ʀ'$' 1|Ыs!d`|7b2̷/2 XAD#%cfWVvo1k<&!QBTR"hh̸aZN*% ׉l Y@yQs۫DY᧳@]<ʺ"&н%pt|(WA)m-'.տ:!D7 w o ܎^?ͫ>l\k/R¨m~@FDMjX{jRGΨ-^(cmBƾa9b?C'k:_Cji o\M4Q@Tќ:9mczJ!oįBCPٮ4'3,{vjXB1` $6SL[*^)Qx+Ʈk!.y%mvP̪p$PF.>i9(M”QK'*%B ؙvg΅2`I>J:R(<3Y)U7GZyAX@VA!q9){őMYC` +8h<mU28GSK e+( >5A:Q f7UG yA\q3 #vxhu!ѯꎭP4_j#4SxǶd78,ݔV8fZ(5@Q#9\KM;^:{w'f!Li$$>+356EoۃPM>ͨ2mFe=`(a[\"'7[3CИ;ⅎ|ϵιx;X {2J LvyļvY[D}~PۧvDG30>kl!4 Uy=$hhy7IʴqA=#]5wȍC-F=LPVg7U(' y)}-ί'`Z~S[ȥ$wQ%@",#?h!Qt*ou谫!QmWDwJZvH(j?3^!g.s{}þÀHh3Nj'т*՛HʛCݱ9DZG&mǞGh~&.v:mƏk )}յè̌ !בyAHKA#[S.u/`nvy\Iw AiHAA 96Ϙ7vUfw m'2hdWe֌yc"PG}h"w(Ot Xi'u)ɵޫP6)W E,e1+wƝ$c+RB.Sht/*l~H*5dpBd:U33`,#Z.5tb;IsܐY] Xo?bȯs!Bю프~2Y56@͞Ԕv: z2Jd -^Qu݉W:X0JRcf9ڼJB(" ▼]|XN#xB[09].u}JֳLtqK^K oLC&d<ꀷiXɡ,[Ҧ}(멥$:CNA/5"UhPJÉQfQR Pa |xpAtä Ï|X`^DPp'Ք^b5 usq)TRQJ&bT,{rĕ#/pY {!>VC#|2!:G̿e,xGB.B7OFXx>ܔwCqmUEZ1AV[57{ba)wk-#ftWKc̊dnGmv$߬bB?Oh;R(uy+ lz%BIL00XYMK,]5jnubc- 5?%%Z'=[U3+A56w@ƼU O~ ϲ~@v9">.tQ[yYc ;3bnUR|ט|~m% G*}gWM9lM;_WX ʘ!"kg{]T{WX͢M0hUxNL}P)99 ͐M@${ ?hsEhWA=ݾ,H)hB;:uDFVeUsӗ~Pa[UIp,73?9Y7WN T8wp@QOOH+ eRoy>o"qy !W`uߞ"'!02aU=v+db0À2' 7T\5RMDB6 :0^h oo8٥~J3F?HW/EG3>kN =v@tM!8.6RvTI5Xy5 ՜Xi ?uvw}Pm6֪Q >fw͑,$7Æ$ErEğ6<`CV$q0_?nAAPEFX:*fmcoUxpuV/N([!fvR3&LiItN#?7dvddgK[w!lʄT2WXyug~3ssʼn2q U7o0 SWXc#1  6^zXiYIiPBm;SLhq$-qT=I[%ހbFZ/Ib :$pFGIAo'9evJ٢%10e!յ`s-{eLPa h7=gs89~07lRc"X\Y<{ijT pP—#lJ' 밒]iNULicwKsIY6?jaLj6#-2+$hyAU%ф+זFmߵ w"<י[Ӕ}/l58{W,BGϠ P_uڥDӫr|6$pbVg 7H5S5J}W j䵉M:WB^bN'Yҳ0qBHtMMr*5^!b8J?χV<2Z -:TSPe ױ? R  9ְP(?T;tVXo^c-e< aAZey'^`}|w 7(NL`*$VsGؠz觻#G$ە,8׿dю4;D/Ոp֘߻>Y6DPz5[@R݁J=r),iHձtȣ$b+OXmeJT੒5&(@,!`"C.GHZwKޏ馴}Bq&L {;dGNJOB|)yZGo|/{/ц`*}hD)ik2 0gW?p'L9F)[&7AATHlAcF=0&Bd.j jsY 4[ĿFuvCfP- 1ؾ]MSpک3TEfLrCE>m A! .ƻξa)}y>E1yHjG]7k41yQ G`ss{J|`j2b<8=s̢8*dDлD ıǜP@9)zf8 _dzy|ˣZY?sc=X&ü7*1tCRW aͭCu/ $e'Soi~4M6dew, W+pG֚Z`^jTky2I8ԭU@ݖx2/'~3$R؂Yav}8r-> 8&a{"R%!6o. s. "7jS}$5E v?R\Q :C~:$Y>@LeH"P:G""C"٠ç(| ABR"!tݵa'+ bƖ8r'*ihQ}[„-N:pIhT1V B\%4 X-1pTC(S\ u$S*7 [po7!kAbK7pٛ-uW# WPC_xA]/9X5zvxOd;anqkV׋ivc lٯxxQς)!SrJw[װp+֘&|bhW>1`pt{oY6FvmťT:iFn{P զ!e5?eg敱{m{]?sgHF/ɖԇ/>,PTO8juE~XƑjW$F~g*f*!'H/;YȊ^3h#`Ǿ)Q^4\͝o' d.#粞)EHu!\䴰3z.gzϾLU9aW򻭴LH=a *I_ Cj;lj0IWVQA>KNRCr,;iw¯ԥj:~N͵/y5I=Q ݐ?8Kcz*M%72QmGڧ[}n .ܐI)X"h ]5[avzDױt8CH!8;u)IrR2:6]dԠ>x"j@rROD[#v4y6 .w5:JXd5j܁ksaq2itU{ޛ_JcNlg,t0uCn}vƁ>_d5=FO8ɤl'*'!ʖP ޵D$TDr{R!TT "q6\>OnoO9{3ZdߡO PIv;|*zLU)HnfGW}^ȠBɖM[I~HH2V8k8뽥i%]'8IRuF*\Ea6*&]&4Ъ!ml+( .. Nd\^!uc[sO >x1/ *$;H67j r̶@}e}jRaJ_cR9~nx .H`ׇ- ف$[]RĂ|" Rcř$M$3 b' oĘiEqLe~љG(rB}P.(5QS@y_i`̘֕R|`iv eH)Ck S*Ҩ#9ؔ h^o;=T9=IW֬`“z&Aaj{x׳#)E@@j2{/ 6q[_rBҟ3%?47/u@[Њ^n!{Z [ (MT>(^<.t=n)KcU5匌"+~Ep0ؿlUp!βzVN!XdEQ OwWkD[0xyLIpnM1]7 sXT;_=n=Z&@N&|o;}̾*\萱 g`ړ R2Je^9 7I/UUݭ" |nӁ"kim@[-׫8 Z#;!\7*CM/ b|t<(rh`RGwk>cE)^;[kwaLS'FJoEA'&|t8ps&&mZId+I}wi.4<#C";epG-&JeȖĊ诓|69ak~y;mU϶,T[>3̡^!CKG0搤g@Zc>81%{v`#iKaJ3mB7,_HvM(G?* a[|2RuKPia%TF8l8?: =.oSMdajݳ<)u૞pX˖cޕW1{N41)kb vT@ri90\Eӛ~ =9TrZTۄ^`|n}N7V.dV |wLѤ &B5B[3#qa*<ڎ˨>_kSkF{Q7ʜEJE?f-䡢cj#I% ܥx=K`@ ʍiutQ cFEv!(zzяƆiw4x5M`K[9jW[ںP.akr|MWoX)4ROl]K'|YZD) !^&llc>բ. =hj 51@/ȉ͉򭆙W[֊ϳֶMM`^q \gv7,vp˲-3}Q|xmMT~2w4oݕqSb{~̮]*՟L'Cȉ 4#`bdx*teYEZSAٝ:=jc,(K +D:i[+-Ӽ+Dw/ }uUn;Jr-5Zi}11q/t;xjj)vTzPzڥGr p~CH}q嗌o/FbΘC峕Bh, 4D ]w-\͹%0͙64Ou?1C" 86*5kE\7] L,Ugw) &uMotp}OCUrz xKUufP i,̤&Ocr?L/hHء' 𓝁?a_F'$gӚ4 1:ζ+aWP #{iZ[eVǘHׁ;ՌIzK(0Hքn֥; Bf`'+/ьQCQrK+V޿AW,On1`D9ïIOޗj.$J%.U#KiD`Bu)($8hcd(؝}~ī[ܹۨ|́~I?= 莏 b\YѼ(+荹o ҍD, kpJ:Xg #R^ۛE81RR#hB2 ?| E@SH};,y/$DvD顕Z.\i((ooTuhoO)ǀ7n ogaSr6Ed\ ڲ<5P˧Oy@b=T&t:al*b#n^d1T' ~`*Ujsm{1mG~U]e(tUIfdO\IA qUJure|DG'Ii$,Jg^ξXN iV˼['_+lwĈ{~LX0RC'agxz}v >jlRSqsbi :l'ac'|4*Yk912psn`씃<0h7YtU|\BKP! $qڹ7yT+1ZV..T KyF pȮi7FԏE8"tiaQݦߨyR+-pț2kZ8ZL$`|^_ 'n~zF3BHWq4OL = 8\9Mo( dDLڰ=WR) 5wFX^"'$ {c).5@N\@ f)l+1HEFfL npn3śj5F5FՀ雇g<Љ%'^`945>1HP†`ܾ{T/oımUqUv%3x![;s q*?ɅoȚ)ӻ#CuЯ9hqGHBlB=)`̗h6Fv٦xkAh lr5o:)$ YD̵"=]Xsm[M}{Pf L*;$N9ca@.d7lu4YU@>{% ʾ!W,@:1"U4k+|8*¡xi&͏;]9&Nա=cFgjKFrCCX l!S$Qw0>%uaΉ~1w x{2=Fbí-׋v*XEh3ouJ(?\_`=ΉY4 x# nʦfU>XFkly=(P\t c&?zf"cďkL. zF`Sp:sWb)kcK7%A,č2ӚҼVL她K״e&R|H~D=yqfP Eb#B0٪֣qs_[s鍨~MPd=3}<,<%|9M.4aeO5xȌM!i^Հ zioMx+a*l_晙Fw17ȇa# j7ΐ q;ia GiA~kC3iŽlB3=[&PJ$j YjEteWļ9?]6|P fk Aѐ7&7έɩw+fl  wRkHRнC!|WrhfaXF(H=HtM|"֐1Sǘ;P/]?E-]^Wy:t<>Ɣz[i@odѭachu~15ߦk5*́ גdUaunn Hk{Rg+M /hL{!"w2ݵ]`ZIJ^pzID2ـ[I5>payp/L Cz@c qdQ G[)0/"i^ ߓi'܊:*UY3yll4I%_Qm=%3Z,d*TP Ff$5 9pd᱐ @\Eg(8>w(۞6 5ĩ%(rCz ?%ddi/]lX (ȎrʳZ1ň8pG+=[_]CQRpghj\K\AˏYK0]f)IJCww\{]*^7o)fC.W>AQN CW5|d~P٤kQcTp5g',~m#uGdqKjY#x` X#Uf`Db iӧ7 &JKZ‚|jꋐ:q}ds!yEN7w"1_ٟiy"~pC`3.F0'R1Wp!yе4yw\ MfS杲hz~UCd.٫\8ZHDŦ{L }~&&FK8D" a=1Oz2| D$zh/Y<ΨӚ5PDe졡r+%3!Rewԫ YV ȵJx.#Be']U*,9U_GȌ<(Q>bmwQE~ُuvacN\eCg}oC>s$ALS{|cn(-  QYJaؖnT6(ۗ.EдI> gܳKV,?;"#5KY-o>9@~%]jw ž rpNEE'v57hTոGMR/sjщipj'W…M2冿)j@,]Ψ`$5@ Y>/4ďߣ*n-hAy))z{ qv\co&Z56kz*LW<[05VB'2D?HfkG9(է&wa8S^kui/0`^_hQȸY^?_vdp"?sg!-VjtdXBH0QPdQQ$ ]&kS難_A/RtI|A̿_k`R B C F*И.V 2 ?ve0D=vaȿɠӳ=UR(LC=yA$q)I,"SiTtzě0S̨G<$>._rɎ`W_d+`&k_=?i|-:-wnQP>Q3NSkDȏwDu74bRSǫ@ z2{iXWJ4D7;>jI| n30wms*5> e<ډXy[Iۋ|[Ezɹ[` q#I/ZM:4u鉼N4Km.`rCKttE7!K bk#S[ӼWUJ^b;gް[ TqF z²xإ>yϠ]r4Q%殢t<0ў[ԁtuf_vTLP"IFozi--z܇O+?i+-TZ6=*G<[ ~Կv_=v }qQt̅>_nCշĭ7~.n0^$IXxl-Ϲ&^94Ru!IP~"J&:%xIvi&ʬ0Wt3XNP{UPBd+ ؠ UN_e0r/ ^R8576nn'k{(YF̀g\]BO9.Qxn" ( >P* ?y{;ihy^L"~53xGӣbm ^ҧyEOI?} 4SVfm/xwǛ:1'xmNSN\O}EmRȨg8a*u|*/) ,#}P PUcp)LOF Y!!]눳XZLkV]D'E ckGKq m)Fo܇4/4K6(emIIw~-LZsMJޒ$~Fu 8jVa=r;xXd(9\DOs{[6ޅ^s.uԼB᥮NV |WFCl}܍Pl¸Dhe/8r@;ss)Dc1]HogԾ([\8]pZN@ *wmrTQdMOV?қdޢ7d*蜋6'{5V2=eK[u4.Gͅ/,xmCIa軅HH74^W'1<%;cVI [}ϭO_!$ i[f8g/N_waFEWn06o $rsA҆+(K[b76 0wM 8o{#]6(x-/yx:ˈ LĄFE\[ 9C/.9ƥY\zV 8;/u:Kltp$LC˰!:?Q֭ō')wM AXL* Cm;j@.1+lNFυf>n_D "ہ{,ޞׁd*06ܾ_)/=x n}<Ԩ).]Ҳ&:ìSvɧM+#n '3 3X&px̸fTH+kBD;nRrf҇îڤA4`~{ BlK?.4B|YCigzv vZ}sn"dnsV' MgvDtLl /AokB nXY<8h"{~uwucOO`j x@,ԼkOؗ}IA|^( ~V2ܚ04hDxi5 ?IYaG] ˜0z~Vպ9/\xxMgmMKY[]WDg-؉L^ ^H ^=36 v:rF5XdYu㎣7}SrSvprl*uVX#'@{oTWI|U-SziN>wd|BmQF{U֋yQ ov %? sLׯل܄LKf腷Ejkuf.,'BIQ`Dvt6^NJ ci9h!K ΋ |# {UwZ'l9%P\Tw7O]VyXҌPlє/*7uHM|uB*T{T?,`ot0Sx۪^J rL*| TH _Wq[Z>#^F֑t!E@2Gn^ `-}u»$czûQujy"jV/ (IV6C梎^( BҾYZ&^2fQА1_Qo~]AQ@0k-e3шӯcRCW@sK&vԐ^(̫BfW5(v_z =v[t&8Uy77_3pLT|(7S׺g& *bQH#wdɾ6 '-goh҈EVAsW{U'MY%wf=n\';jXS.&?4A@'SH#QE=|y{O3Q^]X"YX.=VCs"Qm^Ĉ5 Y!GeWR--"CLGӈf +6E} T!TW!CxFI:qMn l/5KzVr)ۜU9(~Rgd]0:53%F_|?hF6P:(Z ሯ87$'؏4>F 2=d7l};OdIC< eYuf]Kg@QΙ33"$%ADn/pJ.+#mN_[cLOlG8W ^e }捝ԕ]\҈}_8fqEV W@_ދ$`wc܁- A1܂h7_٠o` cıe~%fʲn;Í@ϰ)ݑQ8杝! p#kލx*KᎪHZ7Zȍ9[%.DRƟJ_9!{vD+~4$,BY/3 o/~Eߢ[Cz3:c#c #e'!2CS(w} FߴɃ$e|Jdu4deMI, 2Fe_ ~̊K()ʀJ[&桷Q.u؉2My ̟<إv(b[G> +q 3No&3&d+w ;ON.MJm0)ʟ}}߿s_gOHuG3Z0u#pqa0B\sf]8?#RYy[rHk Ǽ~Πڇȹ"q7D/ln'6(#b8b:B^S2&UMDu",fL-K#ݞy ,{\$9i*8*) m~vGH?lx|@owN cpmhBd bj2ֻ{i@,Am*zZmzNYW4|J _>⯉C?P<{qR4̧y}<k00$JlrmuD{DC&tg,R &9&J̆nˎx/XQ30H&d,}ORC iNb6&'"pprFp 4᤹){5#45fF5ΰ$-8z}2| 8<_qN8 1]Wb'$4e~Px/+G~OO+ M;3Fu_mc(x;{v:{`LN8 -}e4| D!dIx٘ T2MJ姒> K` ;Wp ŋDVS c 7;F*5k2;,eÈhcƩjx[2(2;0Gh^K'Ťcb_ۺ.7+yHB$1+KT~`. i*ju"eC7Vym+r{@?A~‡^xJ?v@-7 PPCwk̴ bJj* D2#✅{p6 >BZbN#m>ˀ"(5֥n#\Mz` DjTqU?P"c l< A\,},TdAٿ"2WaO·}^K82۬>I;~pKya aOIK97rc(G1-%z ={6vA؃uآJVk^mU /:^@ڴ^sMvƖHr9e]( YIc?sHsWf,wTKUϮZ0RG,Rktɫ~,\FhИFU+NUsFҒyh ;) pQrKˆKuRj,{OyIF= Nz/$sLT◔H{Ze.T1U܍M>,]0!51Zn4G田Ū@}Fn[K<{a% Ϟڡ(K8wL|:I;9GցWӀ&;8*tf^vZw:/u/4hTR A")H jQUN}uTUn#np-Vb$#ι>9z( 4e 6{BID*'"rNQEtb_hlJO@Tղ ۿ>Cz4ZπBe"B)~pC\eq"2-eprq爯IJ'2LMhlM`J |9p"yӟ~#qU»z{4:Lr`]Ef%rc-2 *-̆{U Qm3eY At_$&ld!FL,Z96|hv\x,'&,nQ֐3Չ"6Y ZH?69ClH^Wq(FO-T@/: Ҍ8b.YJ>UA?[EP=A=)IؒYGbUQdqo124YK~Ղe ?ʆф_b yQE N#$)F6Р ՞NoLFBgE; AnWU} $! =Ʀ0_~t 2| j|h}uf=*k2z8K ]|ŷ2hMCe%v}lBt!6xX6G΂zHɀ(9/p+%)y[TDgbb1r]]EV0θ^eDz>2PS$s Y6Fht)J|@XCE=Ӱ#_mc.q0RlUZt.#*O咃5-s h?w| jQrSe /6U?2M2-iz,& )J bѸ\bXYJ k3zYU}|s(͗R4qBU"hF^OFF bJhƢj j ۳C"`:CqrR !w:(ڵQC( G[IQ>.C+WYA}MZOVG,Jg4!',yWräb󚌽ؑ/ ՗BAK<!"q\}Ԓf-4p'On\y76AL6Ȅ#qeѽ߼E%,eH $kMl1#8n,M VgUs lQL !/j z}ٱsd{x$Cr7`CeǙ֐vC]V9E}tAQ\X7cc>ee$xۛk75ò:A," mv)'CVj5SD3p#'ӂLjs-ƞEb Rԏw2.VŕV9E*+z1X"~m\/i["%P{dIPVЛƂDssb%_CP+d˱`EGAOMa]&58o L BEB 4l~˨`x }fXegaBMիl&`3Q[1B"/]~3m{P Դ޺|H_̞T*ZMlBo!e#mt:`ߊxSIuGzVjS)iaڂ_Se^& \O#E#tƓH^>S7c tU GKrb8HQV. r=<"HUWp'^nI! IZ\Pr & ݹ5(mj-Mc1d`gkHƆdug>:^j5e/qE]4N4v Obw"BL/,?LH?3`Yҳ>Jިf>\w '@*$5nS,z-&|28{蝑l3iggzjs#lt*~t'm΅oK)3iJ$I<~7;Ug{h$c[i 7}]`{N*sl /;b]`C# ٷu(ioϕl m_q)B~OSEV5uSV~yF fY3dzǴ)NF )OfgM4sSCI#'LPSMNf?Н: jgJec̀8}oM1~3g(ɷ047݀R k~S<*X ?`$ВI&SXl =QV-@bWt* yq4>?f7.q`Ap2>vʹ^V@KbclEAcE5]Ljjm:-+YoҞ}Yi"+:=&)(vN2:3r#Ҋ8YS<6H|A[e;/Erj/"Ƈu=r˝&[9:c^C)d#]E+^`5!ٞYGg6V|Q#cqqV%4AH8qOW0;xbhfA3NK^vAm;&~0 u%CcLg{) cU+K5ƁTĖ=RQe#9icV.O'0ECф>s@֢&̿ԝO)  sv5n~Z^86X7\;W{W9w"ROKn+5.g}*KC9]ĝ/=qjciֽدNr7o?QG@=ׯj>_> 4H^&IiͰɞBh0H7'hg"[3@g7 g5Ԥ_qzMMD+՞3e__He];\RtmHx|4MےJc?F :6jj4^! Ѵ|)˹_h`$hMV~x]4'm@Wyw  oTsKC/Nrpբ <.=c.ߘ7DI;_w~ԄV1(;N;NHM&_ݱ%8dJrPwB,ReD Ot[aM`$PZ ½gҔ1hv.pn;QWV̏_W))wyWQYx{d}׊-/<[.AsxD ! !IM.'A7Ea@~;9_RzpT}E"c2KP`NEFQc$ h 9&fd[a 4H.k*nj)@#b/rb}z&kEzsnRVUZ/h4`Ttֹw)LbJ.Eӥ֩aj1w%Yp[1Qܶn3+s9sLBL+/:#E5 euG0jSD=0xa4/x I0͇ 7 :2R  3ls5]{݆A=+.mz8DTǬNO>nA`e:[^<㢆~[6U-yOoU<&N]1IYB0W f 7iAl[u!d_l]Z#SV(qwiGaM^El./+ju]rVmqk+oYKee/3oHL,I p…8ʹ 0qR~~ _7}qӯ]B֊*ɞt,=>TXj )\@I8g;9R.sVqS rQh:d,Ἶ_Uhrl%Ɓf0r-d0?W:h᠖De.]d[-GƯa}Mv}sSL _d \-Mt;=x8͌ԋG E{܎tTb2{fɿmM(1WC ( '._ʎB$Kp .{8{awoc캺~'+ V6 JU`){:|$ǘ:=!; @0r4]"[ [͌!zZHp/u3B>XRy 'dpi]j!kҗaoYL?qwkՔ%WF%Fy88`2ne> 0զrMV(,q>dY6-#t{T@Be5jy @krD.# jµ- Xj0' Cۊ+0(Q(/tI3GJ腴S&}3;!l/R0jVz4+wF1H>,}NRa^k|-&dR]i4 )@]SjVp{tѮdn~UD1Dey4TjS*!iu,Hϩ2|ץeM|iP,I<75^47@&1{aaƒSC8"-:RT)x&}xdBvw3w=;X,.K|;x'e(PDUԷT#FEܢw8oO2ZfP3ݾZ`Η3}, -%~% FR'\AьogV1@5~g[Pq1."ILXZv-|Q]&{S$e?@ lOr%r`#f>E;Wk`?WiƠMƮ#I:"<v/ i&-tR[}o^Y,iTl:w}3+sB$}U)~\YQ*0GLC{|T 1!~9kd7f~2!iH i~OP;6v*[XFUw ]G&P>a%T9*Aܐ:̽2"up~ȴ9*U+xp Ys(|d*vrcǑ3J1Y>1em9-=XfijZͱ<H&xQOc4D'?Recr?J 3ԺDIJFϗOZa;jzAxhSxё&>_Q>4~l =uS w!7XC5/3*: f7@6,f,^ìHe]0}flGs#ydASe1Ӕ2褷.'@o\&w-'0S)Hq'6|Ta*CH9fS ʭN`%S/ DeSBC `=mҮZ'ŒzHJѨ价wfM͒ t66} fwWs 5-3S+kxB̀-KPb\Ĕ .cT`a76D*.˕z^QsDLP=*pWJ @ݸ &&}PIOK'Gk)&Δ9^)y.{K =[.ܭVӲ1j;aBvWq"`l.GMo֣]@j9%WC IK#=\݂1"2wG~3g߂ύJMnZAv5VΚ 6_ۆtc54Ă\#H|)}IY2\%qpei/!ՋOw hܞȩzSsYl1S}vF!ӥNTjֻ 1fPt92C$P/Tm@?)Ap2;=R4Jh] r6kT2EF ڣ,O0>+Q6)'Weܕ8 OI_vKڠtZ:.PR{ghDtmsSnA~igq_.Z%jڡ$EQR/vUv&y`#O"@\=GR! muAZ;3%Z: 't(#JrJf~!lvr1@~'Ǯ Rz2)XQAeZr|<|(lϘlysvOK;`h>R׆ASig4ub hN|PtPl 2t$ Eqq^S tKK"t&Gut[8Ǽx{)qLnu}B6O]Va y/@[80d,9}+,COtO[gUEnhQt<[gdT8s0ϟyEj]t(3jx?!^ %'TZetOoXNiߪڰ>0ڏ<:EHy c)euel1.Ѫ,@~'ׂщݛT^fg.g^ PŽy#HRYLXyYmvQ+dN/RҌb.(PPZ˕Vad Qҋns_yhސ4MT9;*A_B@8%:z'^Z2ٚ{8MJ@ɫ, OLl#M>/^!jz2- bZ<=B` ,3W(oYcYEm2pYOGLb:ݰB0;]>ǭoYo.` R[QG I hz Ũ_Ry(̘jZvOSq?W2J\8O@&;Qܹ#Z{8巰xXJArt+Ro/&Fe^p<;n߬Oޡ:yqWP9~:ilQ ʂeLC4 Rhg UdT1 M s`?vB3/%ɲ4^QDCus92.K4wͻ$k$p k4m`G%̞T'8jt#HTVuxKx5IMUzRKW0=ev D 1̣EFA%$8. ܁`fÀf+~$ b wSN{c<zblD˳Vo*ty(:GHv>gJM72gvV%XRrV 7z̗GhԧˀsZ䚉) v*ͅAIk+ lp!λXKGs=Ut~yg[sBFɎhy$4CۮpH<}fO@)8,ա bfS^#ADiѥ1y?~;X9 xf5̓Sc%di"⻦awDߖ,M{׷pU& #D_uoPDm@k r#0{UEՔۧ\4G {K;3tKФj҉'%BcxmۆQc͐7AيhkXyŁXmm4cyq},0[4nR*cf;% "'qriN،re:tn~1B)?Q3竑QJHͫ_ܥZzhy :rF|.|Vu2zUNWQ\MG%c|ĐYyut?Poћb KU7J0!~ԨpXxb4XL2NiFg(5atŋZUm4 Zu[T! ]u]nޟ /RMRAC+0nOV8{ً / O0qFSW<1;Ns e%,aRqkYO&ZAd蕎CYA p!Ւ*7Qp;+1sW VgG Ą$mdoKUcS'#66D' =.8@5;"UjekU0Ps_=JY;l Tĸ9]KP`34Hq܂EV-jw>0ԝ J(5f[TM>Ϗ{C'8'73j_/f=ͬ=r=YZ&i'Zg/ 曕 ĜZz8 'wű>r{b%HM]ؠ!?v,@' ;4& V w L.)$FkrL^\%}4Q9n =eӳ2D$\aOu~GJ?H⁩ xkF)U-8H._̫z͠C=nTs-RWB7Ox'>}gsMDuKc@*Q~p`H"];B҉uS~J.2)Fx7Ö.xMb&i sI{7ݽ|{H&&qb@_|2 V!_tC ldwK[>MD -urkn|O-;v3CN 5#JBS ;Ƥ/yf)Xh69XѮ3TRlQ quFr{X FД^ZUĴGR(={6wN7rC [ɠ F^*YJDHaYtkJWs8 79z͞ `؂Ph顮0U& @kC <e4SHB9c̭u@擎xi'dN==Br9){%+L )VӋHykms4 Xx)WyH V> cğnW &Ґ`٨j&6֢*ʃ0kZ ͗2|c,Ĕ=q/1e'*wCVvn72dۇ3 +E> *X[hC=&XD&GFQ@RBЗ;p҅ݍs'.W߉cIk[?1. eRO;P)GȩtTm( i(޿=f|k@'.`-űEeuklgXXEM 89 )%4p-EXqt }}׉|mw/❚p(P9?>hF$$! 0TVƣۉ wjk={"~37|uLB/pD`s9nqk9Ŭey˞"xߡ=( gHTg_h +N/Y@ {gl &O*չ5KZmb%w؊iY]9H{A7CDwU`S:Dh]ghx#ÊGBƭwI.~nu ܭ @!JA(c{NXI /vtƞw~+;7X`1L3*4H Mt8HMAͶ>Z̧tL@[Yc7D,N<9Y#0jee-lpQ=:LѰ"^/jgf/&令O}Ť£z@T"dwӶR^Ѝ IfYW3 Ք4`4/¸4sb9$҆פLܚ)KVp>`KKt],a¤['S0p6y8#5x]AVԣOf:E_dŸw✚ciɁVx1mscƢ˗vpbw~G6|8Sp'3jd=P׍9d.7ҿ! hI~qT}jj%!lz'_G}\( CT9ҥh sػgiKwƜ+X %S:^L* 8 BIpvr)GErX~O*CpuD osPkJ@*f Z\?Wg;Go&Xr/1I lĕGt!Md]H2U*a+9 ';9Nlg^G6uDؕ?*;̿I(RHa*0SZ&]֭ɑfv7Gi/ϔ_>ޟS;K1ћ21Hͨʌ_a*,\ۂN)#FbFw%/69kP@~M6-Uja:pAs*Vm3mxg3!"z +m 8r(bsM9bARIѶf2|xa$z.%e-:I%kS wG6^PբeV‡)@ 6'#u|+Dksòz"\&x)>/iȇ~yԡa mԀs T8ߙR&P$pzQiLSr\5- Ss6,;׽ Zd I[ 3+}&NTHHl'.L*#pjk_ɞҌKTA/g(C,͉YyÌ9*Lj.ɏrPyFtR{@BoT9*b\x6,aёW0OK!F(񠤪C?˃ق$A󉧼kG&Qy؋8eyXj SMA.ECBe9~){:p[ }I9vu$yX-AZxi X@nF $ ,K^=A"c|#`ڧnSw~wٍܡ#m͆)hI_D;Io{*:R~]:Co:wƉ!&,f^M4jwY_} ZWJB?"lzAf!(?}Yv,Տ A0Ǽ"* $.'!p#\ }$%3mNw d {kȯAe_/eP0^:h N* NS;Ucgh3 #tq"9#I@ẃlZՁ4:F%aJ/y4XoQ. "?mRFCO cΥ%ezw^r[b]0zI0d[FiQ+ÿ}_f+ Đ-V얐F$FB_zig9`l/wP_wa+ Qvi-p D#ti)z7d uZF}aB<_p ⱔWB@lzVn7h&i(FzBiqRU2pejNp3MsKm 9%P],gC6Llbh- gpwuF. iS)y}LvQ 202/DHxE_޲ej>2{puVpUB01Է)/|%PRݕ{_`Àq*A%KӱyZ6v4LZ#_+3Z}Eҝw*=C_,ь[FLgPͯ%ӋYE/ETaS;3=^w\wf [2_̾!L39նHM"jZi}UV Xĉz,u(=B\^w]#柧D+a 5ZiO*"(g¹TWTg4iE+yKvFsa8Zo&H \t1C< B^wy}+Kk7&nQmfG$nxF] Lѭԛ(K5P̡mylB ؒ;pPnA$ו:9Qamm?pQlT%M";ׯC%o|<$}"Py혭JzjԐV5[r=*Zv,|zw*g{%[;a_RGc^Avd1H;JTҸ#",ɠÄa[&]-|iR[ {S %a;+dA ӥPn+K T:{$f4:T U#RB >tfrvNf]jЍq@j$q#ճTNj=&];O1C(+KC r GMTYq#E~K'UլHӿEyRѸ[IO;$-Fq $v[et9u5W qnet7z pFpuBaN81N{!69t8..?4X ۫VK.ErF oqo Id 薚I\#lϹU-)d%_WG"{ ;XƺwC?2m]5֨CF( ҳɃ!#GD)Jm0EL5Q0gQWRBy0q3}n P {X}A^7C(Y*V 8Prřk!QP1Sm  SLeAcZ#SԦ3'7L(›$@EQzycCe1xfɵ.~H)B[EUFjea%dXZt0ߘwN{,2ӂhPs nKqw.Cf]â/p7j9X.xܿф :~P{,f@WakA|yXv ."B*^LEN8a@=Hann6GF8ݙ1'v q3;lτxK*jQCڤ40 x{ }|y='О ɪfɾQn>`;-JΜIz qYwFΧOGy5Cܒ`1Ο !J'L+cz+Ǖ<1ʎEH&QAT }  иOt7]$AT=Fv"\812i0Bڲy XKcpXnSay0?S5zsPWx^M BXSBsA;}M{t})Y}Csb@z% =NAE&ͼĊ/4Acˠi iݮ2@], w^ O-|.iP{Izp^]"ҁǺ3̵)20+ r_Y?)6WE vN}ըTQl][H/&oojRKxoxd.אo7qe*Gv F=xkA V:yFJ2մHP@ DǼQ! ˳G;7:&ϑ2דNu @@w20h?YӇRBP%<^eߏ+VRJH:,){8^9VE,/kGׂ Wn4;Xɢ| *#gfe˃xAM3jJ&)8Kj\7WQGV]*OofM|gF*%Kئ3VbXV3t4`ҾXظHeWO'= fEjXZ#99q3/ &%&_W Kv"#rݶUI&vCkbW*f4#L7E=$m@,J"нQf| >9.gAqF7IL+v.V8@4$\[q(fT#DuŊ=#UpZsϱ(4@JG[-*yƁi;#aq(Ai=f'ćNÖM3Y'Zڷ(!J7HKŧ2=w(}xp鼭 .4B^*a೷K %握ZnsAs4s˨UPf'#G_@!%Bnm֫$czyz`m,˃B7;T7K˴:BF\򫙿IZ~7z03"A@%ǫdycǩ|SF 7*M %E d͠WпI noj,^[L=h"ϧ3k)xp,LopȰ9>IX H"noXJp8! Լםzُ`鹏bc"#C$7ca׹AMbH|:aߜ$lE&f#H%-'4*D+ F +aYoz$!U~ȑSf~.ҼBeuXk4vpsBb 2բG$"##=ϳThλ:^^=47D/@χ CE7Qmx $^e^ҳY5CU促ޚ/o{]g"o0;e0GfO*p.[q$[%)0zxo\Et6X⺨yY@n^G Ii7弅n y۱Eu)lB-C9Wћ{)*\lyR9ך:6qwMZ/,*2q屃F u0x4QuK+9PнƮ1ҺB@Hu*:3"j9Ȁel>mj\.Uwg5j7m54XL dp_W[pT0̍@7K2Z߫i^V$V˺&4ZI1} !z_|xrO$bZ|;bl&[o@g&W $[ێ:Ub"of0i:p;e-,U~=*<,qb:/Ëz++XM8:HސNk$5 ,a#gޭnی\agojF yo]\7y V-{k8Sѡl&Ƃ$x~^3+K Q(Vvngl[zI@lReu^wx \滛f $-IYA ԪYFreuJtHb&[z@(Xf= JCX1;l&҆]9uP0VP_I<@r@W//rEȹ1x{{ ͟&rh[ֵL:h{ ceʈ7>OyreRR/Tڇ74}v,8^Wf&wb3.תJ\kU$JV}ᅓ!hJэ}ƿŕ$0?M(rW\iv7*/G-13 `cy{& \'~uA*o<а: vurVϋF.ٔM(?UUrW cD,G[&LiHkcD7":{!'6-F(_MTM 4`^?~KJ9&\!erR}ߋ-@z*>uvP1QXxB]TxjAd dU{qJhvbaWXA}L0%#Dc?)eo̮aD^0^/I՘Uw\ERw/i PPGFVo.s$YWWicƯCgqu0zva׈iG7_=|)oZ=JRW b 5$%wlmRMak:&Ԡ};.n9#e+b>Vepe<&RO+ߥ2 P,=5غnwY܀Xpv Et xJ_.&TVr2;θ6bwٺri=*B-)·eT)2i@ON5># U5MLm"l<ʋfv+9JDMm2r  ֮oʂ޻YFus6tzxd0re :z+`汙*^Ja5yzeN|<^et<a<٪,W3;ށW#_%<ӆrutA,-U9* Ñ}ji0S@ZWaRmGO9# 7ʟub#p-N!E+R*F1V~nKh>w-7l*RYyű {#] htj ,q(6cC\9anGO?i:ބ/q52i\gzw}$OSx'ٵ"v;=pNU;.1% ![)Jb=VrBTzrE H0zx=߆fMT$XbgiCCdqoaK$HKpB, $$G˦dhFeF9׉!JP$]7* =s_nd<#+B @@Ȧ6śj_ ᄑ)d7.KR y}l.x&OLsr,]췁 JUm#"2@ǀ:REz{hB! d.0(H#ݤ䙑EpT E&xwenK)syQh*>J~7WNI@Z\ra4ceXMfރ0Or-Jn5vt*Ny~TW\Q*X($>:nP=wdlbԑ˝$$!א4Y?y<:jŸTʬ]q}n;t~}oɄ(`EDE qT^ LVRbbH .uv>+WUpf8P'S< LӁ`Hgm4c[͠wٱdQW=[bJG)T-Mh JqKpt!9h%LDw;aay;AyQ[VCISM"LS8lE}41Q v0\$QwpwrnhY|akO5Ā W+xa|Hq7Q:Hy1˱U*baYneĐ86E]`eIǎbU(\̫jV5VpڷvN NqpӥAqq_Wn*DwQ|L@w(|Ti7ň{St[4̜TR-,"xw:js?`jv%R;Z²!d}pOxNٱkͳK!g|jA8b0_FͯD[zט^5߮j.|~:*x攲 sk/DBHg95"mux\*w'ב:&{t-*:)HRt?duFF"zӧΰa2 Q0 %P;]BN*ԉUC8 ^ȼddsyKjt-4xVsp)'P2ɇ i#ȦUӎ{wG gEtN AVUcޖvwC斆 GHÿc,GO `5i.K44tJϓ ZbcK\ YH$㛀zj;0=Ƹd&jh6.H׷ `)Fp-l(g*BIzHp4fvL jSa(K$㸑ۃM=^`"n/_Bp3o2iL(9f6_'^'7G>pmā`ߘި-o,g< @~PJEҦe(WXNZ`/$VϋJke_G]4坤dT<1Od[̷Q2HV ^ BjK8&N%!.-ƒU ׌}ۭB"Q a!L]4˚XvM<=GԃB$#G_ [p*KxFrMS۔Iӗd= 䋒+zALun$Gf9 G*|-kNeЭe!w|06G1`Lq8$H)D.I_wUI:/j@tblmpsXn1)We*s_(x(;ZH)0t;qYL 1AgLYuu^KF2kHA4:x'26שӦAL`Aۦwݣ&,9aNlqOѢ$G64B?)( 19aNRSu,$GpE|2VmG]1b&vLiqTMw$WFc!&@)\'nKF*/fd $pUݸ.Zh3]nK/ W 6Md1.Ta?g^ՉWj f K72 ǩg ɃV}OYp @/%PYG-oA 'ٍӪ`1!9p("))FAid59]:);5)5-ynp?^oxvZxetiE  F 驳M]U?#a"hp@>K 'N0^]MV(,9~FY{Yܯ+\A]'cibVW"1Kt$dڞ>|p۩++fJʣl[OetB>z{3}^a xu7%@'g>#عo)Sy52"aсUCyΞ(`d˿ ɘ1k> bl/ήWvtn .R=v-%3]#m42LCW]Kj qT@/(K( 0:g190E@r󁲢8͖lJ1ĞT m1UN]BQF[yR=AۭX\OA#߯:É̐)g|w۽gzJ EͺiԄ`oj}}qaxk>,KFޜDt/6611oCA/V3)4sF(ա!XBM3l'ACr74!W(%jLa# 򅇼T,PY)d:S1n9IZmS<" yS9NQ6eIU2|!RB?!5EU/+7/ &];*]f3UQStG+{H4m`$6|r%3Kh#vԝxI@̎8> )g(;W$1jS S0S稧:bs;,F^eKV!q!\_d-{.I=*sCȆofuo{V ̶PKnE~p+ ɧaNhE->5^pY0zu\눦[tc:阆K-N|%ռnfPz|yD=4<ӎZd.۲71XvQh1FJ]ʶPR vCrhj͕9%~}(aFcp 1Zz/w|K"N20V.Q9 ay)aXŻ>"J;a;=G=\ˏrπ4[ߠ,hp:̻.u8O0;%= s^bBT4jglYhx)i4GWW26 Ih乐4Ʋ xo㲔9c8w>2-älϵn(N(6`PRP2+m-1K".[)KR4I Om>(O$u(G$(gbԨ[̂#ya唠LNLRU ! xyuh Gjjoor`#1ka3hE;5dlpBFs&Vvk >WoRQ*$ܻ8$hbjpqMl@8h~/yo<|-|纴3_ cn|s_7˕#N,wz ZӢYW+%Mh$XeIL谸_ewAfEz +,LF n^‡&52WR\wVu(5>& H+Lz夦0Q? -)=NBO]*B4 vq{ %~my:ɮKiByWuJ(C@x9AAWlHWǘ ©M$ȝڮ(e7ӈo4RBJ^uqrH;7CuvׂY<ɝT/e'Srvu)g,]VJ `z[QiG/QAN-aKua xۨ'u6w"]|޿82X0 ^& [(|"& H'2 Tݝ7N+;;L0<-=w/&*gANhwEe|2ux (Q8 R$USeO4C(A8I+$lmp[Q19Ǧ%}S K6o^n<*BW ©{f.!>Be |&(I%zGd$ #F8eόX]z*c7־3|c Ew*Izro~uRJ4 ։(P 41Km6Kݱ0X,4@ha#U-ڥ[yU2xmIs)o34;U\Ճ|(ZuVz&DvNj_G+vGπGJ2벚>J~ (VDD$>YHWH, 4!d-܅)f @dy%y?Q <;QT< @yiNԁڿ&Gƃb;Mҵ;aIotqt}Ly H8m}-n6re~S #nW23}V)ԤiX*QdX[0滙itDR*k^tu]$`Dqɬ5l`+lQu'GnS*ߤq/]5L;8c ($ `R5ZD/ y^J/[lm^&rZ|,U|IlvD3!k yP l%PX17Q|1y3˓QE9J2̋59X-ZxN3SNlD/ K٠JAN}kСw w v q6Fd 1Pz;`@=™ǼGRkB{fR6 [,GR退#QrFœbs=9 =6+1{+6F0uwgp =W9 `[.8֚S:eq0^}ٚ E!)$ bpo43f<[k|'C) 4 Q _0ٝ:.ZJI4v VF vjPuj[^ y+bU{n*pfq#w:5Yu!rË[jjAY4FB> K2) $I HI0a!,!pO>C٤{< ݤ*HCM}JH@>6QU@u]@i]ޒp,x#&]JYb+ :*`K::>W˸6J٦FCt,6I I ^nǓuI<_3}v/O{K-!OowӈހFP!,+FV6Sgf8o9 ?5z5qT rϡBORń=]* Izu>Wy}l I!$$ +q;M|,P3ѥ>ٺ=CϭB$h!.{>ܧX>2ŽA;CS{ 8/"//B]*E =Ov83+9omn`&5'Ғ0$AV;#@+[^jw_-䙾{XWi)d=) ٤iht^ٿxۜGԒBBBw>Uxhv>zTHCa 1 IOH{RmxY7IӚHn|^Info?+Ξ} dڰ=zIu7Кl<#y^~.S ()Y“XV6D<܌54G 8:xk?5Xi"K>{1M\6mP)X0a^!f:Ci=/w7@4۶x4+&G~Fi[P=R a&<7+a$7<烁^&;-<8 '!!$> 0 dk!ˡ&U)u½9+x L4Qb|BȲ{46S;7j2~sy @q{; ݊ & ~K 9̄'d No\%ζ~E4~mSh  b?׎G^Rwo,tHCaB[/ E2)PU=_}/(\b+{+ͷvB;TsYLĀx62C*ƃСD\]rikBCjP akZqY=oWUL~U+4n 73'T)&cd[v`;@iN3 F: d!:Tya(u&)!<[zHȧ΄;tT `OV'sY%H@"'؁޹CFoU/x(I"B{qfi F2Rs7O@|s67gW7&tN# : `ϙ\qaNg@$#tz}?j@xo>O}C_kc<y|w@:q.li}4}đ5y5y !I=ܭ&\Gٍ/󢽟?>Ll$D;hyU]wZ͘&F Sro ~V#i' H ! @@3i,G! ]x1x #cSaWCn@bbZB7I],oq<󑉥`dqJlBGBD JIg$@'H^@!2^_So|}[7M5lQĀ `k3heZi2թBjQ ;cgif~b4k(y{SrU8 taSEF\ItQd?s%S+#  !ԏ}! ;p0nOРh3fN=Ubf$|Ve{db7g*|[M[>U|0~a"t)V?nl6#cWo.xV h0}ZZtf tr1F7;7&m.txUcAf!H!L WO%@ 2E<7(t}di%{z?wawE+`h`h4*+IɌ! ?ϟjGR_g,@`rqys,_we$ޒ,;W`~:sNڥ+54vA(jmwZp`(gUh|R.ӷ!lV(3r= ~lOmhHHB Þeyδ{=x!m?_/}6o:$kLy><=(R"@bxbG6@!*z~x%<}M2Hԉq~cپ|w)}/rD4G'0$,K(]`\S8w4Flr g!I fy3Sl Q'n%CM)ɣk5],]Zۭaﺚ{:wWd{Bb5X53iLIViP #O$!oKלD@d *4T%Lv5}|~\NK1'BfB*>xP.xP8B^Ԁ bf+fnݳHLm) ǝWnL&m&^s'B|$B!FS ?5( 0$?AIJe$@o)0 1϶M8ړzfGkj4SyqJ2;He% HB}zZ<r^qkӕ|qB:t@IbJm*<!)@8^cm{m68A'>Bk>mTi\ho{f=o 7ԛCQߦ9w.&Jw;b8hXKN|>Mb]S\Đ?ZBn3Y^rm(@/<@ Xrfڏ^)wiLz1ᔆ"r\@ <#E@ŒI:Rq{>}MzZ}kgHm5@ 7] ׹wc߈D־ xbP0G{謮zlI•iWss{iv~Ƌyz|0ȁ\ }?-qdBt$e,uvt@S^ן"xZnD@ _xSCBxj<>Մ~ _s6l&?G%l^oo3g (kQwx6¾/lWm21٭5>}[AJW%﮷FFYWd$!zj.q|4w!3ZK  =g?5ׇjld6%eyܩ"32Q'OC7H i?1(nFw/ȱh=yN/EzE,L@yJ|o@Ex DBHq:mX=|>î%26!~-W0=fM;i|"k]u P @i.Mz-,T_˷IP?a ߰?DD⟈q@}9릉_Y= r[a]лi x@JCo.%;z+VZ`I4Uf7u^T(D_Mj%py^K\>obvܓw$)"9ՠ{NY s{WϼvOBx|zc] < ų E/W5=!ߴLď+Q w6'mTEsI1ίv*^}K?]Ͻ!Zu=Sa9}e:i0^@-\Qkg9Q;D4蜓EDH?ߨT.ˆ|g`9 qvsMRƖ%|YvG'7i=JL=狫;MOVra')~r-Lf98!}ӃC|l0ÊjgPp>.r>=ΓW(1텺^jHmޯ4omjj4:f=^r# >bl=&-гf^e=z<:9yN4qCSs߻rYJ;S֞k-wZ⌇521ʿA=_X }wQ N~u.Ѡ@^xRy)Poٝiyz][8?UE$7mի{zB#> '!m^އ-uu3oJ~Dl캑.cO3y}`?>sPCgJ?;p]'rO"5--)Q`PM% "0ݜ|d=6]~gCK_/c75)׽-孒ɤ4)&d[I#B8Ꭴ&6gt1&#amV֗a)<퓺OP'_CzKbh?WwyBv[!:BiES;Z}xZ6e\&5Th M2[uuJf`PQ ا߬+꠨*Uԯ$͕e~J&x "ORtzpD `I8o^mq|W= hh׫ִstJ|FPZ"[M0%)QO@$5\H{|Shk{v\SP,^'F?3NFzC sġP5oW ~ur[/MB"2!XӁ:Y>?7V8u᭶jhJiHLmbMp(PbuE( -x6>ds=+QQ'ϯ4mc~JEwBb Qo W9;++`Y!_H7m]!QsYA2se^\,HVF>ǦAf8ȁwYdΛgm 6"r0Hz״ 'qJ|AKb])X?m=f߉|ˌI\\ユM`W|SD =' ?Hpxs#4l"EmSGgI~`vMnMĚѼ'KRƇ?.˓rpHuj(\4W/M0ץ^6HB`!(a[3SK*cHk~<ՆN.3bv+ӆWr* @ > G${OOa)uwpCAzύWuSz2ӄObw(1+ΆL3 iƂYe1 PzG*<:T6LδNt=53Q*Bcj5e~,-YNNWr7*qHbi2JG˅bK#!AL5Ԧm>=9U8IZO&jܸ.4wѫs?/ ,,9#;2ϗg5Y~`Ss 3~/Pbd4Wj='̏?=yͣʧqG*/^㶺ߺi?hU%oߴ)/[`n\4wÁɸ-5Em=YI,?z9wzmٷw/E vGЕ3+?4t5|Nsq}%컑;._A$ߢ[F][)!~B~+C_{C :|y0G?>Foy 6惙ض*/*oɐ4_}bq6v:>rU))-k}8Ҋrry\v Ehݻ]vex?x,kp_z|T/ N⸘iXD{MMj]C FVC=uڢ~< 9ojY{wIj)F;Az2dzS۝~JuBq N@|-Bed$ s$Ll ^P7 $+ @XI!?/@ l rHB2HHC'CX3$  =xI 0ђCI$4d ^΍y|{zOpnfR_EID2'ko36;iPg# fZލB%&@=$7v_P(xd22|HAII;d!@sQ$ߤ `q I:;q0a'| 'ܫ`H[x9(Igwl$Іᐆـi$2'f@d6RN a'~꤆'gЁI!Ba) 9lnv$-'3!d0Ibd$cMs{C $T{+\yuCoDI/`oBT,2X`ZfKČ@o5.iI $532r?y餒NŨI9.FCqk%D?'{4P3 B'U!L!H! `B~$E0 @IIa'$ 76;C̐R@=P 0I v8,!4; qP]i 3!!T~@Rt$dʁBa;7.!ʠ,C$M$1&D dw>VNk89NFC̭$ӭ6cPm+pm!@6ZTAIi͓r;zFizZ!  & RP$a_J'# 3 FނLu~ 'ߠCU , !Hm}^ _RK<}1_wvWq-E$ɷd)2jHr\ϛJHēkm[~' OCnA ;l狅N5U%*AbXupX~ډta< TfC8IU)u pU&?CsDY'e[_[Xؑ 7"b={oIOmD!BmCI7!$5В@ffNݒX$٤7U H )Ȥۡ ,2VBq@H ];4!im`G#ac30RBkQSw@Ȃèol2pKp;7$=3 wQ$ i;2*- CͫHn9)9C!:=:Nb֣$s Lt^k$[Q0]aؤglNd!f伾}և) Iڽ44h6웇ni)4u*bz&htzfkrYڣraN438Ovqh5@ ڤ4^^≙ Ed)i2N d;47jQ:7C! mIu!d& Y$!P2rh0$;NHrP|=M$잚l3Iw&d gA5X2]EU,a[TfWWuȸfo9i;=smiv!עʽj F0{BWnÛ΢I4BT3޳1;]Wnq*htn. LCrpw @ro;;FIAX+=zv+!Cxͺt)ܡGY\s RAEr/- E."7,t5㭭]\EGUߜl[\>|5_;\ltrʷ'Wv5hŢmnm]$YƨKfFɤ&ȕRjMrjSQoeW(FDF E"x-k!SօӺ6֦aB6<]5skd3LܽM (֥kX5EY.8rMZa1gw91$O>r6HNp"IME3Ա0> YX+$aa)pCbШP4҄7IQSnj]V3NhS~Q)or@m nR];-IEf@ \^9N$e4;J#JnjaI:AM o"ޤ cM40<TCzyf@H3 HtkM$s ZҢe(P5XY,-Ipun]'"M<4 b`ɴNaM*4zZvάٳԪ+[qE*FW]aQ'd-8\'7:Nl$'q d93) '9s:#xL[ܠY%d@ZϰVH]k?AoRK eᖺ> mgbjTqR In^M/M 3$@v &$c{*&VqӢiy-) zb׻N-IЮ# TjN׋]w4= E NaPr+Ṻ@7)JuIҴvUM%0B"? ̿wbVg5L䂬HZ6܍Vb1"8In65.ν8JI;trPhZ4b*t1 6# IJeqz7o6rYN}K"բnzg9|^[4@6v{ɣ_[ z; x:A3*wyF fv jdV;m=cӴ[Vc1 2&աk}raULxF%c4"+w[BjsZ # $!.nUs.W+'h+47 $ Rhz\p2ԛ/|]NzMihP`϶}="zHuWձCT}٩(g5+oǡmяcQZ;n<6^X.&tܥ,M+3tFڤn\S S˗:ZjŐ;~U\neɝm^CM&Sh IIVSLc9Wn^3eb~kw<= T\;Ĵa>5Q=ar FcgIujCrγwo?yS2df &!jw4 )(a(Rsȼwﭟ1 Së)>uмm:@uauH:]e.;ooZB̢xC$̸wz yRUbz/L!QPYG?{bfB\ bvB\ g )EzU$ƁȌ& K t|MJT7ơͷ"J>͎v9*A^ v_ )D> XyuLw'|ֺX0;TBFrmfDSDa}NmHV Y·qQ]>'>VR8CfӶ7Ɲ! DUU$.SA;*]MiuNQI_w\]wwwk:ڊ=sݻԴvmFEۡjwa9#\DDou$qLW@n7L[&j7uy8L;0z8}/ܽlw.WM!Y<$ng$+C97 kn.& F@)51)B ^OfKPxO9qwQAEjqCd) [Gk-L^"_ M ygw)UՄ`IMìHJ7%0ߡ}.ìPPPjZj3]-q%tezgI9=*vϛd&Czh[Qڭnn /XADYjꄚmbxutWpx<-=cvl&,j&ᇡ`Qz{Sb a|xCI=!{ Ϸ9OK t=e74LA &gW^w|~j^ض '"LD6ȮکU ˺ңK3v-qXHI<ժu8&۝\z ӨpS4NyPMCaѼV DI8(Һ$H@VqȾ0r\Ց9k4 a7uUt2kd v廊r)Juڵu*pk&hHMduOP-" PXCwɿU4 RΪ- }\V/*];9Ս fhѪa`T BD:<{v)Y^ 8 9=^iWVH1ΖG|CNNzvh}:3DJa!jؠWE\+JY(dVnF$ł`/J jܑ*̝poĸHx<5j5Ѱk~ d<`q I uGriݸV7Ԡ&>^dNhuy%$ïERۗJ^cXUWc2W0pg01T,AGA\wߪWNwUۚTHeI.Cn^Akףl(Dw^wyU24:哂Nr6 @-O0^ %Ö:)܈0s9.Q:zf& d:^rvth/onJHj$ɕ3cU"c9Tq& :d/? ݽh<%!@˫B IH ,BڣqSA$:i8Rsi0HWy>3Gu{:hO[Zy-2-mEbN {c3ZI<&r]* @9 }O99Bt6M}ֱpn v"X$ҕ}Z r\ziLDWBhC@ʥJ?P$"(X]A%|R 8;=s$AxdniBpD:Bµ3[w^#cqp66!cL 4"usvt?1qF&[qcJ$85_nwx#q5vz5E& YP=U)M6Jp:/(zŽCf\CZLo'?YGU68>ÎWQ5ƍl/ (5&( ̤O ձ.lF-RZaz٫j[n`(ҋ-x\ xkBZ ȕm4+EK6Ab)qGSSP*xCQ0Om_7BO>ً|ֶ6Cx@-e05y֫]V;wwMsYyFY()PZe̫L9ׅ$ î #C};C y7.I" [KXYLFlXA<|X]' rϵx`qmټMt%(١^wO6z~Ew\ ¼ma2OXƥ"7$_/IIld̹x8\C.&a7~=50ԙc7Ԯc]mTnn`%*M5JJdR8Lзyr%baErH0d2M U;#m'kF"@UMgd9( IukŊL(t(lX*SU\"BDF ,D ` @Nx-%imҭ5!)Eo8 0EE?]C`M6n{y;5)QHslWI@ѩO2щ@BpF\J(uCAI .hxEj >U\L2i YBhjCMMdIh`Fpy+D!YbWwAAſ^n6BC{w֟ -@#ԉASq%2zSWjA1$Jl&;1'E$皜vz pD,Jn.-s&Dys*pP+tm8QǢg9|-~ϞL8 #mnϗv{;f6M V) 5 oVor5y{Ѣ~?/mof/.[;0w`$"BpD!/=41Udِk1NӻS9:KhIky^Vx;ļAv a!9tQnЊF!!=rr J\ɺ*v<30-m8Ċ=ouJ/liO@&\Tjc[D;Ko%+7n)# q0TG2:U$IBTBLɾhhB#x5j#h4$Q[j9b"@""tĀiZݘbflܗW"sᧁ Bsxw 'ra7&e=؞G @Cxo ev xWK W>f^%G3^eq%&mS+"qT"Cl7,)D!X"d ag0+0"ٮ0BK YBDJ4A s:o7Vtvqztx/E$$ dځdP'hE w1#52H /*icj).':Z3jbbεYưmUdڅ h)>P ;ޅB˳0NQD0VJ1Zߟ:Vm%i L \9Iva$5uԊu{9v^nз+hHnY7 E.Pmϖ| iOL43q3K U]@@]ȣZtnkEF;AOʙr_1̥y u^LZVl'KLdIHʳ0bSSc@`=EvY.6/\*[Sҏ\bsm==jnd FF1fRB?kU={6]xEX( /{ow}\>kS宽yz )ɺ֔ԫT|}wL 2 $QAeYedm;.0`K3zu']]]{!Ӊ5TG:B{ * Ї@CpBh5ăG Tt_ FCl=t]ӻGaN"z[ -*[}S zA!K b+澡 ^sBwRn )9/> ?=3 $lH#d 4wvUR/_/oGP5X6  JҗY2٘C)cP1=Zڙ?&ֈ A50lFBQ(۞X db;r8%&DႰڥ۬@KL,."ԭ7c} <æ}XL9v^'llʉ &\B|>jɽ]2FżNǘ !!D 8IhP sERsNieZ.VHȒOEbk0fH$B:+O EqA0jNZT_Al XթH\7 ],gXH"{XVuO5\C'Mj&X۱ AD.2." u^Z|=rb0аVqՂdhݥc);d`P#%X[ϟRl4#%.lQ9Șf<<ȅl mڛNڛK?6D훻ojU&S JfĻ6;}=Z6\NM6`r^s"Qf %v G/]3,Ka>'KX`)@^[Z"`!F M7LS vk i!%H*^Cl&M ŁWwj# WwE@R1`8Gٿw4ɽ,ZLz.YØlf %bOQr|rj[yN[ \IfOȀ+A`3k]ooyMLnν쪺ˮ#"< 4ol1-Đ-iVujq&Hm;`a PH-S&;hJ$ "K[S`l` XwĿZS؉$ O8ieRL9^bc|NK%*@4ғ!LVogŒt;-Ső aÄ$ @ <,xUek|]<|\t%dwN+  roشjC1rZWAȔ&"fo`&ȳoIH/`Bb.BV7۪jxH\1 h8T[ԡq>g\˼3aPykY帰ص[m nJ)unw\2ER9+ں.$ R TZw^ǃͬ.v׵5G_~ŭQQuE"JFv)"uFs\]9uwϩ4ΝҚ;sw:2lA~>3hQ{) Ȑ\i$A!H=b7!aZFno3!H=)$ENZdUmFz6asOPsL/^ok#:e8ip22':&<)@'i3IB6Hi'n3Ą{&Ml>%d2G㥦0,kOgPUh2Q'H4vMau HThs XHD\YL,|nr)uFο"{/ nuym"*ACjH*jtGk,h'd/-V_eR6@+MԔ!ALǍ|YZW:ꃝltNf rqDb8ٚZi cݜOg/z n2+mk)\Wۅ{d7eO5[žT%0ZScZ`"eZ&_ŰJ&EpEr+vیYxd!6\H@!&D`VJH(cIL,%G.Id޳ Ad2Ij2E/BJffrBWo(O ;KʏiR8]./+O] 49=8BfND7QEg8#P@+1qa8o&^6ˑyMxzU2-s+b]2 [~t4RY|&R%~7-5GNj1eHZ4Fڿ?_s㫥ׂH0=\I SWQhCƣME@d@|lMq 4׷+Vv&zC%0P%PB; op"+-+^Bֈ>kx8XRhB;jy,Sf\VVJ{_D3$&uX0+5kj/6nVrZýmE D (G G )ʑM JؔLRQbsF Hͺz*$G ^OKwSSż G z4E 3: $RͲ_4[`AM:9ؗ:~guVqEHUL(P(_/x`2z[{G A2Wxda J0w ZEK y(;CC0 \j]ʎMwh!?K@ >ml. 'JWp(C cm@M1ݴ˹(NK$7L\/zDFjٙw'57 q{l'!BH4{T@ďP}J^ʒGi k `byWa|gI|>m<]X}aq4tզ6AdSӞ>yd 3wt8֯kd*@@l,ΜҞmXg #qlp3&r@obb8gpeZ=M3)'HH`+#vb٘k9N$ 1!vLG c;o~1]Cϳ@5&W۲ћ6yV:(;IooNA:_ܿ;Zx6:+Ⱥ.MU^A|!W5dc)_zk#;3J^$oBf嵮玪%aꋵ1$B-18,:/ (D@5{nƗV\Q:|aF@A"hܵ9:k9ƃ\0r Lwk|L!?ş,goMޣsI((*,72ef!BBKT!a,,0ekjC#%ߟҸb9ҧꥫhIfH5$!fZ'2ePf#lV)nuN׋wn=/uçu Rs))-$QahWs{kw^$n;^PZ܈@Pː/` a/Ѩ6@ӾI/d!I @d \T IBB&6 CAVBzwHbdo-,E @v0 s }H@3 ?u Nk!$&?PY tCxVI  862w;9\H"rXBS *MHI+-<i1 2PC]a B`g 2I$쐀y۴;NVg2j@ 2lQ&d$ ۰' ,L!$Ex$Đ12OR9&F){  -!fD5YIkP Tv@?Hժ%cgVU5i* [ + O(UYM$1M@ E]DꑾPBتEHC 踊 af/ߏׁ/LBbaBs t!HN+!&$!8NsBݒ{Ɛ CP$H&I(= $&݄]'Rp-6ᤛ,&'ndt qYS($H@d% BI7LۧA$}@'&2w !d$$ %U̖a6xCx@UUk \IP?UشLđC`E\IQa9n' )YSBr$3Qr" \ n*ϙt _D2B!P$ +wZC!rH$1n]6'- a^\^(A@!I%L@ nگ,f4'51gVR lL9 5]J)]X:λ(*TS* 2{΃tߗ_,P%e) YI."I` !@F0E*af2Jg-72Md v(IM]FI 쭭,">Y28l[b^CTTa$I@! ).2I!ZhP$ [5gVոv"I:Iad @"(MRitwI"PJnuG"Cp$"I/='˯wkkmʭnS g!Y",!3I[j 1ZՕ)԰IU&LfAdEf.T訫˩A8H܀o)+!/f*&~u10i,93إUeRaf/d5jO@27,&- a:LH6?nAޠLi(HFͫ4*ɋ3IEX T๒ MDs7aA!В4˅R cW9Uq E! X}'I!ҷݩհ^FAuFfL?e.d N)'B6&:%# 4[[jK5 Ej¢l53I QyvFEF,-qi/I`P"ІdyɗFLFo:l,Qd$2d@C9Z?=\Smgu-*-RRDAJi, zN3 BwN_-RoHhj9$R /jC9\JtsLl8`-U]~S_`6"J6,dkQEh5FFbQhԌT Rb*LQ#AHk!81HME,%10i32,H1H!& .O.b@XQe2$RPg$s!!9P4-:i7oXpuh.=C(f4b҅#ӛa*cO (a֎BaǑ]C`,T$ʒ*$ ;$ĖAA``4η` N&C(XvRI&oAx}7a7tLbF`t07 (TQi}2憪]VZX ,`FW`jaabR e LQ)LLr&A&2 !a$(ҪuZkUig7RdݲCsà`dUa s@&!A3|i iҀx]#u~!tNoO APV,QipI" UG8Ł)(wذ7QLmT2ec2Ԇɷ*lv$d'dL_ t af j)۔ceOU}$ I`mUdR%(lҀYB( D@i}SKJfdYw%Z(fHZ9N5 "(JZ2H1aұ=ĵ7)܄T6ri pf[=;_1rcpKQA;mڳ0M$ 3fJ96 X4(&HA1)̲,i@(0@I6EHLDS2X@aզH'syEw}=>p2 tщ1cE0 dJd"$*R(1D@AHBeID*J DbȤEPS90DH)HTCmMJ&BB@#f12L@FHkU#IT46F ]jBh4i4I/z d A@ ({Uܝ$ o[S=3 \ #gRY/i̅2bUJUd0D#mX]f0rbޤHn JDt4X5Q\KqU̇21l&l.df5BIzYt ,`˪%DoSl-Ϲfb=ޕtcG,p%Jd>}ߡ0b0PR BdfܘhL)_UtDk62 FCYJb LjCi@m [HLMI$Y3%"˦)hSEI~zRmB6 }m~ůeSI͐ęLQD%6%#fJa-,&1II%%4Yݡܚh,&1Dj)+݄@c}bP[nF2 ̬Ba*Ĭ&LBDbH()S"xgWRlD"eYL*&dĠMh?[fMRS4cMklf%$fP̤d̉%U&LlIddEIZ1f4)IH~ZJfe"a[c&ɪTبIRRM*,hKFS3$)& H #EF35 @١4!$ILbI!&F$B_r'5YAd8{&NeeZ-ey.έ61bD2ZᶁXl3ﻷJ1cPD,"#QF |UejR,R+A}{U_,*I%J[rTa\]+D v`FLllG4gA#ڢ󛌎{{UH,cYrfIi1ɞnFY31! @F p~i9O2Z*EiiJE]]:uݺEί_$67I fDŊ ,]ݪn\e̖Je2SJ$a)M\, |U6}C#Md 賽NgӣԴMY:1aYOH`QHu8$9Eꚭd@.fn KhŹPO$pmT6RD JêKAAŃ"@e-Hy.9 L <,0"!tWCGT5IMq-!5B=iaw~]د:M~lLFLDbDMjtUQ QA )I@v5!$h! RHI`eB4@A$ `W Xܒ.Ep,r<6V%L p",`12" ZIa0J1$$&e "&1$hy%_S};wkW_]ijF r1fVJ\0zTrL<ŴpnӶw3rݱklڙmz,]BE$UҬk<*oM> 12l0t,66Hcb^ VT@Y+Zʄ’$ofB &B*UF)" &[zIMpنI1D31JFn\pRJa1$Br.Yif!H2 8V&u3&,6Wk.!iBǽ1Fs($@&YhCv*ɫy׾|}u3!ݺ"ױ5!+|IEA$6@$Il(E&XN$0I Eʢ4J,!]X0L37` ]U({c^I H(t$떴˚կ m\L RS N !$1>)n4vF=Z8N.T9$\'Q!@sp6| ;{vDi.[h%2LKFsu΋\^{ݣb]8uOy_JZZ <4 40RB^@̄J ^0"7c'T<na>)@͸n2X}>g岬MxO#,Dc/L$"H[.1.^,ҦG~+_"#W/nҮ7@!6fO`]ꝶs|vDY[`59D,$DA(#ȰAj&j *u՟y]ҫL619S%Lnodҭk\,ڭԂsXVw2ZjC(S}ɂOTγbqh8KqS!W7m}ңQYLe:!$nUҢ?zGG)V!D}'Û\㡽97ÎsWGLfw@~uTnh=)èot3Ojk]U ,"+언}ڌ;$UQ$4,&M*u,uĶ8B{-f r19|c~;5^gAA&)`%Owg>PMA=Y?ES#I.JWU?m'ȼE2~#.js8mD֛dg[u<"މNCυaK=`^bCevY

6e9YVfZ F(llA#0؎$ׯAA&WkOy  .|X3nB.97z C(q94+4p@" őx>͈Hu-!k-O?CV~µ A˚bkSxp|ͩ%4pknp=hvlwCmYۀC6R};ņPdzǤ}Aa@~cٚ8ٻQb-kz( ` @B}* Y &L[0!,F 9|r /@_IF@N mG"Oo}~uS*GQQ+T NjTWAcbۧ("3d.!pgw;yj.|D}m=FҼ}QI-74~45@A 48! `( PwR Ez\k9#8 hbZTwވY{(3pGBO%aِЈe| a!z'5?#BR]0$O!x ÖRXli(6 0Ya8<}ΆivIaWKJܽ WQ!nx\Vk %:m흚cߒ$B N_Zm!w}9PNAAJaeUq}n(m$ P^<$b]R-ZTeSx|/}SɎոLMm|;o9{_\ m ;F^c|3-N\હ4&5Qf:<2=E}؀zݰ c"2УsP` oY:?+oı}_.;N߲kuVbGQf7zkW5ȩlH|4mS>DN=ˁOO~'1#$4s.=Y9t GvxsH4^M&{ۺݭ ~'Nŭ }l!`"0@@߄0 Hhm&SWd83|OQcdy1V*IluO}fOMYĦo7L%w;NqrZϣj6܎{ږܧt.Uw\h%dV nׇG/%fp2](? w8Bslx;##' ͭl+;BQ`ۧ/AZfNU\;䶮1q58PxF3q׊i~߬%S}0O3[ Ć[/:Nc) an7="!xY/.\eQ UK*.󋺽1\_A'c}MѲQS~Dļ炓Bg2qu{ۃ WW K>,Yɂ5kyυC}]D%Zv9(K/'ݢ5B,EϹϻ~wOQ8:*i{_ҮPY(9{U˓CtbW|5UIt,?fkv#1A` E. w;\N|'|N]=/)ammn;Q޴{I8MV|cɾIb|W*Gڎ?y fw6B/[(tܿ HLk+y.VlsiӤ66bۢq(x/+:^ %_TsN4S>^nGw< l;ㆥ?qJTBybqT3C4_oR2"1~ޜa4?Co?m~ ;%;f!Z4p>-.C|MҊATgx05NnȾ>@&Wf6S?d_@c:=զ%{㵥iH/b CZkI_4{ *~1#f~asD2/ 2ѼG~}^g=MCŠ},:#Co x\.wƆ,SB|C@A_. k([OFUj9F֟~扖v O91@]kޜߟ?<DB Z>J8K{{#<5o&߇ʼnUR|۔,}W!J`JNj8O I!˒J3BAG{b{ׂNVh``|BpPMHcmoIY(5s3smٻ@GŌ[X "x@Xb1b/jo`b&aMjƩ**Mj !a 'ሇ=Fcc灀# CzH CqVSsaL<^dشv҂?7q/gϪYӚ\o~O~Ԕt -? B??TI KrMFg"Lj$#d?ko6קލ+Q6r;뿓)aZjOˏ윣n43zM7H|ZFZ @!l1 }SAXs al=7*Iv޹?y?+q# HXv ;҆e6Q^=?;Ӻeſu㯧"ڏaAl7G=vro/3qsGV~O qTEx)Ӣ߱Ebzm`\k|G_Яhᐁ4? |.dH}>0+|2Y!Lv-t*x!0--ðǛ]s"y%,o\|-ͱ6qsIwD=p<Wv颸՝|ǏDܸ|/Wȶ~ʉ-ꡳm3dmж^+-4ZaCCԿwnD:s{͎zJtL])?oUYؗߥKi_ScFIU&͈LGN4lB舍1B%8;2WpP幠Jic4zwYg/~GΠUF<1~# &q24!Qs>I*tAJ&ct1`RB1f7<ޭ[F"e@TY|$Q)JYMsfQ~?zǶykn3K^nIJy lҎNh\^/wgF!. ߖ> ٮ7:249fH#t5^m$~H 阯ɖl>,+,h鏖2kR3{:p)o!4j G-,4m!oGӅN*VJPLN!3u&E]2u-D:Cje%Rh]fa;!dh;12:ꠡޭ j] kҍRfO lyum.ЇO_@ǬDaMC͎³+) x.5W,U~o:I Xv2co`7PJw >KJaQ$" Xj˙>YȑjWc5~yp=="")= 'ˮN5_g P#D/G;W~ ߛq0U ]FkbxsH0Y068$kطׄbDJ)Xw6~,Ft]J8;Ķ֭%+oD&i8WH1]Zx4^ nDDCiJ}S 7SۮJУ}nE&5%֍=e1.Izaytvsdt}0OwxSD%KnGLSqVYdA38MaܴWז\s2f&:rŐެLcN@)J.`J nղ7b nc̶IQ^S"]2ԬO$]iٳIj94K'r% 4x`r"jfM0_*ϼyƑ'f1!Na:L]hyf]4+2My݄]& xïUl.@.0[K2r][3F: >5+tў e٨($2͍ܬ}T]&vm +6v &aVksl͛s{xsYURd iʙEڨ9%ii͎!Ү W~HD:8SLmCyR r";(NtW #>h$H0W3-y&Krc&.qL nE ,z(SpS^\L2׮=#hoۚ{T@@!bGi`c#,Fr /(1it}zVEvH B+ [`}%ߤǪ:E_-zIO? Rb_F=ryfaﮞzk">wfK x $<%E=B |H1-7Z^++e%[,IB18?hHA ̓jZcQT MhKFm-mmTkKJWjc~` :uCh~SIo-PM (!; ^o/e 1I|!l{Lf$B8}Im̆33! Gh(6''Pk0{$'NF7 pqpbТ%K׺.sg`Z("ԢHIaKA%ԒGX`ɘhWFLCWBKYslZ$yUVsn%uW"%jTNbа\LX'e.N#,8 ґw؍| ;n$)E;'R'nMk!@H |g:cF٧6ʸp#a.mkaƟ /X+Yϙ4 F,:S }G-:æYצM5;j9m+mj ӕ\-{+<0@(]ϼl#Q2cq߿ ׎T _$ ^#Ơc{\x2v ^ F1[k@  "xy/' zL:W;I9row9<ש͗Qc&Jm'a(P׌=O$ہdN-Up2!K0\n#2-St@ەemy%@ 6%3ZT6T[Mb:oH޺_*L8-ho1Avi.\}JF =OU cd8asSE X Zs& `0)UNO3fZ4Z(FT 8",ϔv ΍:p:fWcR$B!b91;*L(;B0EL' fs(FqV ;A I"'vF6&F@NK锉H(!FaPD] l5}6 -FQYcPq-ei `vfAH m #G4b& -@̀:k"9q:tOj>:hЃ.t &*kHQ^5CK}Jj0#awan5J$ ZNm+X;݁{<b+"t$Q`Ъ%V{743Y˨V.:V6_տ$"4l*(1#bX9%JI^t8lp _/iyiPR21dAV-p$ \ 'EU pa D525ʬw2Z1dk,xG8cNFe؝2&"#m cp9ԍʪs('>z#{V RD@KAQ0מW#lNZ  OF ő~)n wSNla0fh9&361a ݔbY_wyS~ƭ2oAD, Aʼnyv;Ř۔5LKdD<=kwOu(ވ%ސ'`h06!4u\&RjnJ`œ0;%[Fڠݜٶh͹ViNV0% Z8ekGC1M?$LH-,ZGӶi+A@y]؛jH5ɱiVDP nÂb$Q,@)SJjNWXgVGCYKLiԆfV:0@Ao1.[tDJfNg&H5m|Yi9 ⥆ ڹ1XdF|VnQg豨YU$LY#͢WɌ]Iu)3r39{uD`F ``&l0v,sRwhaζH㴃XzQj[x"!LJAa4CeA L+5 mE9RVT!frg 3ah,ٞf--Y5 -[9H\QS<s u3=s@Ai[0k"bPPp@ԪLz"AqE /b /6ntGuCFv38d]5czdц :HB  ذf8*1nTb"3;Ao 3d-\b59U4,'$Ho*YY4-m)BKuUg(L.VV: 1Dy2Ijk !2\+sy="c+!ι8$i=wS/F~TSٝ iVsz4Vh oJe,eqr (p3ެӀѡӯt$JVL_+]m&(TBȮhD<ʀrጠw iT5$&Sc&f=2G4E(!µc :M FM&qbVk KX:'Oc-:"29͢}3 8Ya5ilR#ȑxri +"7 J9@I#C2"Y)lUеy7*mn2{ I:I:l1;kTv2kyƮy2B9OtR1M #'W(*ԗ? g4/,kBru$gLQ%Ŧk*n'~D=$煹V0bQNc ɧ:È e}8NJܚ3r‹g)G+gs[k4 =cJBCXc(d1a-,h(gόl)_3zn# Ii᥻QHFKxWZߡv~lT7JTRսcbKc> uъRHtmKMis-Xmݍ F"A`'3q&8@&R<3cnSv< f65IOD*#DkRޓ$t5uN2(L@R"KI^M]BuӹO-lUZ:U6TwtGJO;33\w٭thlj5KHkf|3iSx>njE!#S`1CC'0؟C Qkm1 &6P!1\B!BR'- Ne6sؓYd#m5,1-̙jZjȈ'O@]'-(~DuKLZD5bjd"@H,lĹְpT 13XNL̹e'?+] L\R5Њ8-gb9Կz2;`B,4\I>ƇiA&_v^ț eNaȸJ/)qh+J,uiZL٩j\i(*G #wKKnD722F , β N鶞r3y rI%:%m9uꍸFTj6u7eZF%Nr!"me aFgڑ:m.MQ:ERtdU|V sIE/Z4A H AuE Dgx lfgDVM*OpiAB ƴ$x g&U>pP%C ΌB#*Ril[Ry>,'j3&EoDKHB3@$]MHHds0 X*O Nm2A8 ;COlӔ#aseLEC"ۛ&VH_ qjsE)n`Dam@A5L\Enr~5M60c:l& * ƈH8&)09͏sU m5qtl^ŊL!Q@FLJӈ%HU@K%G D21<}(H=bw CgJv5 q9U*(AV j(rӛ;ڨPwBn2zkkN'%)8TosdafIb%d d(Cng0b Q# "I bs)k!C JVS>cFs 2v=gʣ{e Ӌ2QKM&5cUk q)[1 0׹B̋|g4I' 1[?BQ$"T6rX/˜91 MqørD5JfcA̭xxb;;F,_GBeu0)aI|lZ_m$ٴAgR|l%0uQxeUEhT+Iw͸qswoj^Zv/+_::iC@"#ٓ"brДh1G c;/֙uۼx?0)ʠ"KA(q:% $.U-12 2$} `=u].@]eY RAخɁnmQ]BIbU35 N膞_xwPUX=* _@QCЈ/Iى# L3wBO{z;W?zV.膹3a۷ ]4*3GF)` KCHЉ4 K-l?a.o6v:7qw FS`C yCqք"VPbr+/:j`DX+@[E\ SUb 9wa:>H4t@טgŏFsCJQVftYl]Ge;q6Òid*Nxm$@TpDCfw"M< p&ޱ(z!i,?'1"ߣlPV q% ;.XӚzwzqx )7c [?3PQ(!pX(Gr1 mY΋ B?tR[w@7o 9_,js>oP '! D +]8{pXCXeѭ~!fHB_iB|D [U3 w?|\lk6`m>K5(+hdeKwʟ_F{ys$SzXC+%2hBF:yK!|&htw=rd{GuK-Iuu{*Ů瘿ԇQ|>JCS.TyT=?GAzpXH`<&/EM dyjoLgkeJݓn]nJ""Z2gm뙴bqvW"*Mdj6Ur;G>j2S5f.]ZS]ݷ$iv;Gk.hkw\$R+э6>}uOѸ_Zp4*?+gLBQk %4(ty蓶7vNHuk ~u˓sl2+ZȚIL\ۧF(klιϬs!Ia/}odf{^K%DmhDw.JgKtJVDA 4YMΈwnmr:IvS'wniۮZ[չ]OޅotܷnF2H(Nv˻%yr2褧kNF~/|-٤;θ`n뻍92IBD8{wXbLȔ8N]]rݤb+~sAj$߲q*7pc>xt?#  $ȁзvuƯ"e̮_o{p78JtGjqw>;|=^.FGG=]vǓp.9̋޶+WB4+ޫyQ}3|mR=z'3׏e_}6Y'`?M^nGjxlǎv!O[/^[8s9ة;B],%jnIT~o#RXO-wRz+)ܭ}4\-'*dUz*.8;7o6lkkA~m8v7,%.csjp{ZZ{0?a/ JKK_\>^`ń \p1'&6gll۴ڽ<?g!>=wJoP;~Gw^7<II:5 4l CBI>E&@8,tX0hC()E {p:M}I>YާCCİM2h8̐ݳ@9$JB~ Hl=$Od !㌄0y&[9iN:Cl!=B N ;]d'j=3ārI89w$iTA$H8klQ/I$!{ ~ d(HB|T'`$@%@$D'eO>M$!'gA!'g ;O f!TBII!LoC>HBfa`HnvO< ,$ RB4 d?@Bx,vFs!&F|II$뤄 <JI ,!`ON2;I7$)6@$a?, Cٲ@;BCB&vډ dIЅ Md =C$$H}RI=;! "@! Cز)@gӨ/M" 7ze0B}$0kwt;IlU'=qգB&4z"%ٽڛa+r2!~g&>tRG,cɛb['~uk`&ԧ}DC|wv tunS y 4xQ%  D,M`"D_(dk115Ez}C)*nR~,"`0ANBqp~J|E 8)_w C9P 峧r4~cr`B0,m)abČ2Y>Bٺz{:F͚gaI<84 %x ]&MͳWW?]7$2x]: Etp&(׈gX~Nb+7R-4oڵƕ~e/ L]9 it&Uo! fe}^koz?eq،dtQ_Sk S&;3޼ōE}#wl hq{<]1AYze/6qn:3C%)[CDb{ļJY:<%X ^J9nkޮ..U]lopLKh%ΩE8m_-AGz^2ܜf Ba zDq($J?`Hߨ._t:{K!')_ 8uWo#= Zɢ2\rg2ОF(kfmnɏ97xe>2^oos2*Im{4꾹5k7i]ɍ̗ q^U2>^[Isi虧-#!b&dFZo2#B08򫹛O%qtyFuj˦½oB&yP@i5&{o8Dovd)}ua5Q\VѤk )$}^OsuXuOqḦ́f#18\wjB*As%4l]4%APb(,N Cs}y:'s#QHr5A.FcOqfZAZ*l7⦝ZwHIdy/\7 7||H/pW$}ݘՌkb?e?N9˟髮VM1{X݅>f%[WqFA.+yt\ ƹɭfEGb!Ⱥi4W:˩gy-\x{Z0=: [w0,xM; 2Fۘc. S[ps1^B|]72Oq\ϓرרB&4rtsk|4,. w> z27}r-ϖK7νuj,2};^R]7+wU]9w:| V5WS]P :Phagl!}M4%￘ֳڸo?/6]Iۙ מELsQ2C.]"_RϮj]7z?Ji{'>[|JOwZ1;I;ÎCB,uQ0rKi@Mm8ٍe-鉍1v;ļmVzT =7;Ļ~Z߇9}B|:ZhW>& 4TL&2V񚥙0q4-ݾA?f=u;k7-J,x>Tvxmy~`bd01yRn8~ i50o *h>͌*e$2}c9WC8ƨΡ֗E0Ъe+>Ajz 0.WYIЃ?j([z(_F1qaɇ-mѴ{H>7c{乫KO2Egjil dg ux# ثfb9g~7يr8B c='訨JY(dKP8 ]eoiv5*;97ҼWr ]@7UowmV}+`n\nTY <91~ҸoL/ڪ`ߨ}'wït%ߧZl#9$J(d 0G+=Yи 4꽛&'M$~zǭ$zg>ŢB+?z şqewJ ^'M3`n ɝ %:[m&L!mĀ~=  ksx6՞yq]-ٵiW\ pF̅žo$ͼvjU0HہW ^%u!Յy:#ST "e@J 3W1nw{P|ͩq[Wِnfg"T0])Np-"(y}^NGNoHc2[%$vYq'?*tw^M; (v4Wvn+zޛMwLQ5ֵ{W1zݗj1("Vb ύ¨ϽU_1]AD` U͋%f#0DXDm,lea}&зt|d&{RoJOE7vO#Of٫}{hZu-$hz0s7$oNP0?^@I$C(Ov?)1Й&ghѡGCmܞiɺH}#>7h\@>3RM9Pܓ8N 'I ڴBMB{H\`YʲH'n+6l'$! a$6v֒A `~c"̐~C&&ޤ$]{kII.W*А֣>Eνw=SN/V -Q^vl:'6D$p &0I gpR@$|@P?!'$bNFBkEI _ϲz I 7HH Y C,R NjNΉ;@ @$}-Cuh!6 B6, BkBpZB\d&&nI$@=Г X !  Iy`.H`O<^d V@?]V>E散պߙw݆[da R@q{],N{@a LBH4jwt4XH|&e`̐'&ـUG`ׅGw'vɤbgݒķm< " Ǒ&?w跘}Im t`fD yk#$ȈF uzyN!n2L0DF.Ȉvn #Q3<{*ɆIZvaVZ)"v.&r'lh_W-j؋݇zs~;TC`e/)?Z1z\G>ۼLYZCHtiwȾՓNV;A@e!?Wo֓SlX%M"Uu[JȚ38!u\]e%J08mrOqe6 ~Nu=wznfEzr3/Ut5ݿCz[W=SV t~<8r{gd1X. u#'p5 JĶU FWhk+p;, ݪR.'{"~8 6;5>Õ)b#æQ9b|ͦ?f:ϿX^=?n -he{s=^wɒJn41.ST<.y 'ؿntgFzU%ol&[`JV.EU\)gs\ĥwO}Ӯkaq/^o|#\׍po &蝆'l{$G3^qͰ@ĚHkª>χy@Ҹ -\ ZS}+k-p$"ȅ'(A@0ZMJFHk,/.( +(L( e>T?${VQ5[b`>u"?(IJ|꠿\*P'UGKFbAoͣZOi%0Yc*>4 }:ϿUOS/ȠvH( {w>䉔@mw`j٥0vPzXN+X=F#eOSY'4>u:b :f( i-і9H*!˦\{VBFj.곮mfn;ճ5YM"W-Zq=Xxn8DB|QD{$jq  q0YJy^&=ޓJhA'h萤W[ۂ|nܗ Xfg-+5z_d2ϳTgYAɦ\`P.ܹF55fGlġ$)> tp'Ϝ;dhR}k%V7Mkz;J_YO󏂘usfi`3T=MsjxFǏlryZr9> j2o%wg%YI)p8 4K>Ѻ; śO)n$ f*EFD P%T V6VR¢r@2pԡ6SEvRhYĐNHk4&L܄fidlęae N(&M^&YPHL4mSN--ԆI`$+zI@DJ(q$rR(ݎ{^vu8ɽbCUMmNA+`m ҩQhF aZfYB&i$Ȕ1v(HMD 越2&HfdH"d4)KEԒ)"2()PCAS2 ( `̊IbRE$"ĥp"m7o.)9WlhHWB(()Y%($a4l($QeLT!*M`U^f,]JT;=viڭFRJQzɱؾC FO d ad$>Z|tia!dM"4$䤄s?e@!>ݓGPB&h6 dݤNR@̒@?EBtMCxIBI!@C#2$ }0 7lz$3 HL&& !-: BqIz`z$s uL OI0I$d yS Hv@.BH,$>,) 搔I>y!@>݁7`b`;TʒHLI [c'А?$Xx߲H$x$&&hI&CH}@I25`C3v.I-2;_NqW]p__E}B}_=PW*#\8O|Ǽd)`ё͸45H,ʧS.4)hplDN+f'=?ޭa>Y!1mSN# ,}yf[:ȼ> 슴Ff{ˆ NxnTӭD:ؚZ3s_1f2;Ψ=LjW;k]jT0¡pyf*?@ń^qCN9D4rsWo9cbLL}wLdnH9Fa4'!"X[j4$b荨)>V݋*I,=Kߞ~?@W׌tzfK؎[Q4)f}gX!p`F fFkA,A3-"{=¶bnz!vLO_3Af/MaV0U;@`u[ku3K^xQ{U#!T˂@ikq{0NG꛰Zv'F٦ VgeU~45iv[[wʙ͸ >]/^~>œ׏wˏAF{(1(@!{hXgnj2WDP Bry^佞I(s)pĘI@I k ZΌ1w->o9"{q3ea^aZ+G[~4Gvuh&Fsm>TșvfDDbulfOg"aTj3OwH ##hL%XK(5H cp:d aQ4g_nZ Q=O-7z#v$.+cZF@Er'鋀}*-<@0IΆ[O2ȫ%'8VXE SX"0q| 36>fdϮGZZ#n}` =\{gC!, ,Y5(68 ,vhPVSxASJVNUF3"tX*ڴ^=n+XTJEp gL+3)H:jpэrR`Ŏ6rF2nڪX2DȐ$`Ñ@J.5@J q"-gO OENjφFp/+{nӧ&SԙSUSy޵ x!{vdV, wlfY &]c;9]vl{/$:pHb=D`tR jf\&\ƶ#S,ZY6(R՚FFcMRHo3Υ!UV|XRAb$8hDQڠ%j !,aRM/J C6yP$8ekme)K e"itJMYNH[zncNe~\MYZSa `̱U:Yk4o,mWr&2mc:k2ܑ֨IaRMX6IFӔxKR$]j8^ g.I2Qo)k0*DhltɼRS<2&k& f2N-X> 9Vj&3:eV94*S*N'wjl ^ Z Z-o!;h4 (],r/9sHXR1Or)*jq!(At^BL!2MnmHa h2 gze!E (PqRA\+"Uik6XԘYt̂c̀DDp(]ab d[^H^h'dZg)! ԜԗR*兦v=EvlD#J τ:I j֐L-{YD= v/qajbҺε-|UA)PRdLx65M#9%eBGtYaxAjLkAk?u62n_@x? QUyW%rh" mxhRc{?C&|v = "$//=޳Y'aDA@ `ZR":C[}Aq3WiZn,( L3$́{*C<Q/m[u쯁?AGQSVB~'{ۀ1$7 O$<V{;%}+C|O.D40WSZ 1rk`B;*3v(2{֠ #j$(wi9)m˟YL4jҦ\.u y_K wDʞ;f!ҾIrl~<> !}qtԁl0 J~pxs~56xᶰ tZB794 "/ Oʀ8yvay>Dxh:W>No¸m~97`٠Tâ[.p;Bj&MfXN+ɺZtI׌SRN꧝p^y,=ǂG3#C`];9G1O:F30ŶW*1Ap3楎2[m$bJljmsj1?{ENR⣶ۡԻy2LzfAY:LUq4"XwrSp0g-+J _|$\^4 o]MmgP: ';W#o H1@n_7Ild|?Ydh i^9luj;G8sM ĝAl,K=DdmI!0ꮶ=Tr39:r(s{ki6c$ڠ>_9MVА_:6aYO"=M_/×5cZ9wSCj{ ٪ ٭v*}Y$F-'ֻEpjM"< g]LI_=މnng~fJJrvZ_*AKo [MOSY9I:q('pIP8/SHZ-E( ܐ"= 0[]V O+ԃB:笨ܰ)& LFƥɁfŮmVJC}mm5LŋƮ8焬lt1U2 h[1EdZ#3FT'O-'-):PU4LdqL͠&[ 앭kCLJ Tf8Q.䌊rdx QJՌ`HF&[x[OqKiq.:dƥWZ.6J 3f:'UR5ɂwLV=U_ L kj?c aD>8ܢS˅C*pb&@tVtJWFDA5GHtGRŷN:r١mEFTT+,,#0e$c{VV9k˕]50.Xq斖[E/|b!l&=./ȖLgLTU!\gaWm")Y(m a35"Ӝ`e jNc[ Qg)TY54^IF2$dcav[&`80%8 n-sq Ъ6x.!,O(R svaI8㘉b3N2MSLL0^աDK8%3+_"dϨ̎ԷLg: FhF5V: nfOҢiHl + EG,,M }V&B&taakJ-iVNs F)}pVgYUUЦTUш+dVXƴL@~g^̨d1+tK'˖UW' z* )AXIKa/*  {H;Cr т%A…hQplUya}jI$QhgЮ9B%!{Oaw39 $HI{5 )C'! !Z?#2uX͐;THLZbӢC:ܲO`7?//1 !X sB} kXba HpЦ$3!!gZoR  Ҋ|An0bko}ML{MIk ҝ_[֓W~.>NJ\G|8Hî8#mR.+nt'q_tfodO_V򷶚'g E=Poa7 JU_Y]ɣuIF=/ GQU`4aHQ]̋##^fc<a ѫYb8L| .\m$h"),Xǘd: !uQ zfC& mpq6vto˶sq?q%c+6ܩCNRx N}tm W?f]ժ=.'yklJI3E22qMSUGE0׾?NsfP &<`Ij}/*;9grdЎ~["=/ KC[:| 9Q}O4Q|]3-I#Oȥ4]N !8S 'I>D'sme.\2Ka[ѝZV E(NX[~})iTxt$ .1'ʂ/bMS=t, 486Rӓiйg!̱F,^G_.ךTtҳ#eҶzp7 58{'9YÄa,eTc ,V3*AʊumxLY0Y' nlja`bFj)_FJWwiȩy@Ԓs_ky\٠kԞf!?@>\( ˝5j_9zUrHܐ8b!!]>e!Ƞ ||oRNbHHsQHл9=zC]t@TLWG=n*۶I8Y&HBM""%!Id dA@BLNQ }H} @q}aӨcۼwkmRgV}_*,9\0= o> ^y-auд*@g`]/MwV+5U~?O{,p|3?*{‰ VѸ9|$:I) :eI/@B  %8~kƚC [$x†A,>sȢ mG˟v4RS0MBNGg |W<.F221*cgz}mҼ=M,`,84ئ[פp]a> !Ew>dVXY7]> XVp3(Q 3tﭏ\&4 1ȳVKҌ\N,Ęxf󢣈EtΧUχ>U.n҃93/ucqL9Jl5ET{pJx3ƺS ct徛\UbaѠ,WY$=+UQ,4V|IJ} 8skzSk 1暶#qӽCDtUU6F)!+do?>z8ܪ[DdrZ= nBYd =SC]|94XMVh$ YOQi.dۤy$Ѡ@I L0m@I  ?!zB~CKv-'_RmgP@;N#hN8]!7Y+;*oj0y\Ƀp Ĭf(o4.oJeu;BTy''QX7]8U>o{ry^ %?<??舜q;yN5%gb[f>Qdo4cOS[8tjLҐc[~F 2`F?0QtK%(74+5 +]:&"XV}ۈe,ZÌ 8G 26w K-Z>"L哘|UWG֪Ŏ;!HX0n1S7QSXQu+Lt.oKzFp=3%zD0~f1j`̦!!ú?9욻xask[c/Y-=_&:8-b()ɴ6Q F|7?UQ[p~lG2;zy}\yUnC.tWp*keX'}2D>舕 Ej@>Yl\K*B7tZ%|N6 ?[-*9=øج);C/ ϦNrg1o &GiK׀*^^%6ӫ.!<K0=6h`}usA`tkȸ#NÌ+ +7SWι0zEG(Rf~%UQ<0k5oҦ8~"%t~\-M(9T9XDaHA̧ЉdtFo[lwK}fey ]1pI`5e7W4.5̅g&!,jk=mnF6|]͗ͻУY&‡j0K'm|H#(fD4da/̝^&P875gKEZ miK`टNM֛H;+\īlIa`Aj'fͲyc$Qv#KZy`F Uwf3'9i A*:DDuNR.c~OӮyԮ6tn8K~K QGM"Oݩ)i?[` |w($, .9Hr/sFPG?38웮񉋠v3Ĩ*0~߷Μ=j_ `֤PZ С@qfy~6G JL0JF oKVUMR iݓI Q_Iy|s&JQ!$ ݳTLS]wo LjG =0B.yп[`Rg5db>/R1?Xx^/v9ӗaCV03 [ʐ!ПSFX P6UO8VURa>ڥTG>OVzJ)5C ~u{\x)X߭Vۨ$گp[3ZDG㐭BS0em4RTHV:2%xvGie!iG0` ՊHX۰(V|^gDY 56Ib*9E=հ`d 07++َ9`;TٙMTcmF,5?h֥hPJ$N3Btob໤)&?:μidr%ښ135g7U }9YU6P0%dV Y(˘Ju0!/*/Y'_XubkcD9wu0pbӔ?"EbBy<=#@kf^(4ٴj].ۺ(5MFL$UR~5\˅>wu0u][mz]mam\W/Ks`nvVU-ݹe}|KrLGĉ5u%=~ct $꟱h`c0 [c>ٯHϥ!GI10I;J:T(q@X!ziV h!h 6]K@D2k-zVJUI"nĤ鵧_s}.m],mܺ^}ɽw=W{9G9ʛϖ-qM*R~yV0f b;xm{upej3$ @9mY LTC*<#_,(;ܾӏ'[ 9 ^ 'B.oٯe~j܋xBKKP_S;.\k =FPff~edDiqɃvVv.x]Ҋ 0We9l,;YofZ~Y: @)_V+EgT1,?9`,iڣX;׷'vq@yËPt IpuxmZOe I`w9Sf*-x{xܟ i#]u:ӑl*E( 1KhbM%܂2r٥@# O p1c<y o5I!Á] %lG|;5Ik FJP:DjT?ejVm֧u+%_D  ܁b[C ֹS:;g~?'.mOr,/"rdK/ "T.*(EYaY^ebT Ng#/ }:Ƚ_ʀ p@jH~Y&.EϒM\-2hƉ@]v< spYV.\OraLU5kȯ :1=vԹ)9ܔf\jY`OB:cc@NYbTቁkzj4&8Ysʧ#4RdYdfJ HF2͙\3CFK1NRC\;إ3l4xaê~ Ca_+ѧc+P2*)4N! Pq?5Pjھ*χgp]w, 4$!5Yc-xW2I!<7$(RM l& #k H d)B,$HHCBI 0Is$|n$BI<  I #$'B rBY.@II 9H@&H@dpd;Bk0&$O$ p a'Ē/@" @'9Od7zQ2Ӽns. '1gf}+~ܻ^BN*y&>^QrQL G_ έ<~˳g9#WOEegjBA0}s;Vp5MLU XaSkUI" 6B<]0iplJktAA,-˄07jI43ASLp6Cהak4'vlxɅ=_}Ux$ F1L H^c78ZB9mqvogF!0>>Pm>6ɣoSp(˖[ty}&;[=62MfOw9_G7L3?EFgtK&t0s;9e8Xw,e#NVGUf+7!K^bW%T1#|±`%;(0NbltB*WRjMmjXESaUд뚌;X}*QF UI6{/FQ'WdQgJnUUaJ I9iƽ?.EW~blfԤ&dl!'Mpy Ãb]'af7n8u?dd?CsWC깴HvznIx !&&E4*mFpJV"VBZueKeB⨼ḏ@* }M'd.I !lCVڶmQZ#U) )$!kRN݁zH,a%XS 2@-ѱICCC8yjۊ8 `ڃ|wfZq0J9 +J\e p b"8R[Gkjt|}wGf=%m{FM6i:J( EEo X7wC<ݻ%ynrڽQХ.l+"kRm?C1e^d/ 8O*FrK&n Ma${턬 V /MCȞaRq%e\q՘zB[C]EaC120=b6 D@>bmW ~Itf{tŒI?GOtcBѿ';;+"0+u^UZSTrs3㓮W++u>O]qxBӊI[U[{|ONȳa+O*н8m]`,Bd}}W~σXݷVWje?ڐ$<V#lY& i0%y, >ʁ{PɤcOKI'pX?~i$3j0LHÀL5\ g$;T nPfm$Iʁ!Crr13ٰ ^+!5PcB0>cɊ ,PY>eͫ1iHo3]8$ !pqikɫ!'v L4k q56 w(nmRkRpgfᛜV!`fI%QPժ+ʭ~Z򶼵nF(d L}=L:18$8 ̒GRѠm9'%!t% srTBRD4g!$_;eC>Aٿu]˦/' .O\7Xj$4v%;\WP)x\o3scL.3XMf!IL^?_cs}'.tBH&u/[22Z,R8\/QoJfk/:Q,-~oTOH5~s澟e:7TCْ^9i ,֮e&ϊ^#!qڵgr/ ǦZX2vqa~k{(9X G*&k'_ug* Rl>IXE>,ͦ队[]Jk)ԦZguNhƚܑ/1pp;􆋋n 7 h$ Ql"NQ!ϗd&g c@"`>)xf/ww;Y,4%I窸 $n䫨0,#2#| 0Oa@>29Y(v{*ˋ61c+7fcG۷?wK}+UdWޢJ#6NF,ZAKQQaHB{G*N =/%nji4: EIos<]{拁<ť1",h.O8NƖ|L2o-=|-X$MI`/XdqOJ"&!kz:uoQwo08ЊC1者S'ӷζlAc1ˌ#ů! yO>yrUM })4`56A"R@J=]o |'m7RX}cj#Lm>S1p}߮XK%1*=n״uVom8cH͆ϙPCiVX5k=1'}F+#+Z-6n%]2n)ҔѶb4msbx ME5%ӇZTƗ9.plZ!iN'%u~ܸOLT[MvPE̫uxݒ"0 guHg-*czJyQUMZd~x[JLJM,SN'x7aү,FT֞ JܗޙH 2*ՑyY U%6›!beuxsaˣO y4iMWL@GDv%Jcɂ f`vA̓Yi]gíњ^ Vd4vz\和wb}T'+p0ABJlLL*(p~#~\8KJsS{eBb&]4E3YI(u_2|n$7|{6)RO?Ti! ~S? T$%Y#TI5+DmtNO%11pIV C3`Y'YYqus61>}C+\ ys{a| \ޔ\^ߥs~JоA_J6[cڛaLVG;[aX']:G3kH.#3fK ;vM6;XhKQ""k? E , &lN|t xЖ"cc,%:ZGwJ1OqG|ǾJː+eK2-L!fXwMۿd)bOCa MsF:TD/|KܙyfdS]7ό| I֧jGl^yx9.V;j=yߢj\m—)ړm Aw#eC{dh@&AS៵ Z[9i×8 UGXyqm%lJFgbd,, J3ga⹐eAԫ$'X*lH)9b0+}R9c+ ^2hX-_t_`6L 4XܲVCmmY3W#+3>Gax‹,Eh=v f:4g{H1(ʺB|p_,3;Fy &,-YW׌M ,IQN4@BSf3S|U01-'ʳi-ҳ!l[,LWF*@ֱXǂk/YMk[ŐLPJ -]B5UHSV u[b97Uai]aqe;4.J0epW#U9kU[S X _ ֪ukETυt6 W}f6V3.qT%.{窑|mW'?ItYUG<OPACҵdǩj39[\'eN Z˫nR]G.ۏSwh_M,M~{')ܼ, R~{{;%nyư1b(,*eݺ?KB쫸zE?mZN 퀰'3_+v eM&`%ڀwLʡD쨓,? HBJ`\I ;&3 C lOd!e˛ >+ <U@ `m#D<&^Y<qy3W`aOA]u?C)(\wt[t .wvlzO*3ce1|cI^ՂOh̬V(cBR0deXмEWS,gԚXg;tXp;#r:h\%Za٤i2Ҝjx$\J9vS80hI z)ύZ1?%2".ig<[em † aץF] 5T[!U^+E rTd/"7)`f<9+Y>[g鰈Im@ۃ:=ULު]QT!43KS$/֊dz^l?=i ͛* D*'K4M-*{UZ:\fک%,a0`(cNӚiٹn[\t:UGɂcܯ.,Ș^Z? ,Kvb7_muzT@٩fFJCHM@ǸkZ BoǷB s[LuSIުoɠ!L7(&&@12@Xa Y۲wC[ɩ1q6ֆ^V?uR@dɅ)p&~u5dL&ua&f@ z}}l{{ǓoȭSѝM⯏U@F))O{\7lXV";Dnono}0z|lͶW0jvCL 6 5i@ru $ѹWie {"2b ct[޶onL}|sk¹w ۽ Tb@)݊-f QRh`WX_?`if!bbK'7?~wY,*OQ2X"*Oc!{g_˓ca\C~b$I'.*IycUj:-^wNb:S:VDS҃tLX]7=? gg)(<(&j$l=9Eeh$SmpL!RLEݮy!r.GN0#|zP?0UƤ}AsTky| (Qg}%0(![Qdf/Ѱ-.Vk, %L[T#gBd5 0z"'pC6o([k7 糪̢t![BG44 4тOβ\} ;H]͇#d2gAvS j*#2D xUPnH#Q'q+} l =9sZ's#h?Z~3^c~~Fٮv {rβH1h|\;8M-ofEyLu 0ȁZAADd%iVS'Q%յ^b飉 H3+v?bQ}`:AD͌F ?ɴ=[HS)WQ3w'Ұ\yeGw8lt-{#YO;' V3糧9)f䲠-2ˬyg2=W3D߆m: À:P 8¨7zчK-;|c gxѱա ,-EwOd8cPŒZVIč&Mp#$;;H%}Ӊ:(ױSjef2Kd\QR D[nm֌d%O9tl58$9@E" OCܣO#D@ $pQ[yV=KL=K19@l@ E uƏk6ņFah21b.i{"ϧyxT?w~{81'\d;$m(04dk氯| +{>XDb”1 x_#Mmq9˛UϠ ;]`5geq"~\]nwh3n͗"\Ԭ:&*=ތg9"`x:@XY V ,$1!A&%N!KƟHFBܥfބ@U|Ȧ 0+ݠgv P0 |r603&_n}UE blTvm쪀-iv@YTT#y'V9N !} P[wz%r,%$]7mbYl5X{TAPW[J8MTJ@AC,2g@+#%{"eI} Y3b85Tl#x6dс ıTQ2YvDT8WQq~ݨ4|be^igK1c=K͗4`ݐYF׌Y(b0Mؓn"G7f\V t ֭C]T8th54e}>\6>p 7K%AM(3n"$O}WQZ+|ҀۀaE0 D)86#jwsw[\boz@RE"*f%W}AXq.|yY*XDw" -U#6cEheȌDPhZ=~g\_eg?ux`@@'"g!P(*VA}slS5IPGfB[/IHGmW!̑$$Am G}-T͉ +\(ԉqTr %Y& %Q }w込my=4w= w]yw܏cq|%=xbAM ŸSS gZ 0c9p$v퍏潰# h:&j4V`}UiZ@`@$ FF"CWW|ݬ djhE&}&L)-_iJi{89]s) +`"?&UQO_'\ 2KK> , CgoKp1[+1]FÂP<"_! ǧFgJ`d<"M$ZΏ~Í<-v 3DDhYi0h oVu+ӟח|_SmzbuqE_NB(v]7n6[!D2rxƆAd⼃H(/4, _];#6t4HT 2 ZJú ^qRcwǥڏ!ԫ!ԫP9>!kgW;>O=dVS  Rhl" eGI,6Px{R$ nbMK~Z"n:{gR🚗 ?$I"[0 SCveVSsyj>+ S˺+Cv.qmonNot$/9آ HILpC汬N~/v-9w1O}Ou YEcf >!Kp;B%KRդp`:._apϤzDޒ3/pfsG^"GN6~ICW4q%2~%"b»ޏ1h\D>9Y'og:8"΃w|ߕULgg0W:?2as}Z .cCqE3WCi.S&~_tCJWIH@ť2mhesϿ$1 <֜~ג:r9f5> F]~Vzpƒ,2{WK$,u=T]Ogʐ,|Ԡ;bT|oall0Hݰa&׹Y@n~`F%gǕ$0R*d·z|cOPh9,{n$6xY`oo'`洓aN# @Ѵ!vy6$ȅmB2` BBBcQmyڵ[F!=w@IfBHwHEJ$ `x6Y!r^O$By$=RHd`\$!Ę"+rfY!^A}gqKiMgYnhԓqT<ri$- krC4 ˨ ^ƹ apč+e w roМW?fi7aYM鱹6 *cSkpP~am|ZTV_︓=t7ҹXdTqqvh>MوyPf+5p(e80_?jJY=\F +]v9~'mC-͟|,D=Z,X2*b`j ]Vb&tvKO WRpnA?>3qMg1hxq _3znY5q9oS?`୉`kE`LKg|3%p;euع~rPPSS R]ݣ~k?/z6B"SX[4 !3ay~ y_ AG5d;Dٌ*ףmp0]&6։^KSxs_'hq]`?럿ѹ $5Voxv *~֨)fti&~1~-Deʘl|"J3Vwv/WWFm7S6Qa{a}ӽ0pPh,H+EU<ԙ-ntʶ`Xa#CMbUO&  ԝSo=Ѽ&Df JM̖kE0UjB'ޱ*_3<%tŹ Bs frnsP,Ût~ɮPNOt9ͽMISgGo 58(C@M}޴K =.?Cp)Ad'A ! ;ͯmi'"Hcggh^%L_}W@Wi/q-]J7Px@lqmB[5TE;vQZjF֎,Tb-7-'á W'EZF^ C[ r(s>9W'i8G}Ul򾻟ߓ4ԪAϯ8p܏\|4!oOf|ip6)F^eV 8ɗ[hSo׻̼GgC"IJ슶?]Ae?9b̄x/p&U#;:w*7݉y!mk,) vuЦjN1:eprÛF4vjar× Ѭ=>< O⵻]~Bԥj{)Z퇓ѐh2vAD#z9u}E \ۜ*3^ !wƓ}+f-)8,@F|k(|%$夘3gZF[R t$Z^:f1n&= B6r':i'3p]6.8sdA3.g{lQd,P)~@N%]XF5ᘣVF]i ЀZauCr by~'vd[8Z^.ݾVoZډ#M<ێ5}/WgGS WPRs:v|%'`uCOz.{„<:~ El˪ؽ99|9Z++&ҫ Bk HVQ! l{Y^󸷟}* cK Zo!:uN()$sp]'Ww= kqT:s|߉@{V`:PX.׿`_XlWz1uT3k7O2ҘL?y׷s<8HƇk[b6klfO^]s ^̪*/ylgH6?yon\)tĒ@f==M7;ޝ;^QCæs݇u:oj"ITĺ-:+|H,:iMM usa=}/Oom(zPe0+ed(1לCьQM4a3-/izF w/Xڻ̶٥=W)C 44oO·k{Kxh0_D{}Zf+4@m1qRFyy4^ it.jڲܟ崚$NA5Pc%2Ovv+ -K_a٠dhFKc+5{]"wr*R6(f>nݾ8UPi1ih=lYJ S ?Z%2y@~bOoXWev~:L;.M=f=vuKZ{4ľ~NUקcIlxMsѶIsl9U3 nq.=EoΞ0j]c(wݚwh >E"uef-5 .Uu1߸kD8ʠL16A@fR8ɐ6y4mtt=D_30jC|:?g!sZ̯{f3:%-xW}}ÿoOy wCM :wۮ&KbskYdGXEk uEwoޡ~*l$ e?bT0ޢupzӫCZȜ7JctCZ--O`ʽc<9߱( Onm_zeCҩ;_C-Q gZ- vwK}g縉{q8R2!{QXHF|2ҍJx (D`m:mm#h~˟2xc_r8 D9FH=/^X^孴TUjUBz$,O60Zm%$ꠠBNjIC΁t蟌fgbxz+Bv !O=ZNo-چYr=99%C&/9*h6 @桽m ~b w^nk_ө7hE~'q \z7OfI LnVA-ΰ|Msouj$ GŜ9']6P"~Y< ρΤΎlcz|;Ov9l8IEY=/7rr9? K-$U5Iכ:,ǃGUhl91,=: pD3 b$Ӛ:@_%-xPU^S~|# pQ\?OTc:BF!D*]C(ƱT!y#5P=P/2ktU~wLogYLWf22-Z!OiCןxLGCV@~qX}KGQ~wkO0uh Pxn)<7į0/z[_gRTX:hJ"9}19^mq=tSrE | ߶~e?-4r.wy-C@X6E{F׍#zBv/ ֓ 0qY}=Sd{YP7hϨH^™koνиP'UO~zgkK8_,9<?7wc|[w\  ׎ٷ?sk"auK8'$T{iWZ|܆'9yCx D̵_ 2Ypa$ @_ bH&qso400M֐:iD DŌ:J%LJwfHyzCR5X+}x4юߧ~&5,0P>;:jV##-[ȫO s QJm  (?jFG73撽#Ԑgk-;:v`>:sd:Qpa>`$ʉ}`sb[ŞQQd_OUyhb91ķ!ZQC?4DyKvL >Z <<9PĺSsuO+DYJoxA|)Л|h9/Z*O:%ʉXQinF[S*UN[)"]='j;7]yia @&o w&{K'<~7#) 1\johPrӔu~xj((`а>zFo (̻#U 5mX0]RC=К-/mà 8dރ{0@L"6uum[jv9e27MQ OVQI% x\\!pНRBJV㗓G'~v FC'fxg(OOA#]P-\"-KW6zdӓmPZ,XɈ5'b1=_]7+BcJ|̸X>p.Ssj0ia*70ցi-Dlː0.*b`{ԓ MaST"O/}i3P>W`voS5=p_DA"$ @ dD`IҔKn_ Fɫξ*Ϥk5.SMˮ!x}iMF[' ZxNxNSV>Mp=)(F@G(: Mve.n1/|Eꃯ$@!#MwUC^xٌ ,E0O XYc(0=@Տm|&;x3J+DkyDTR&J>J*Q(U}Ad:%IZ}bHn^J֥r^HZ4/x: l&p/Peįg;FJrXHyW!,K{5v n)C>Wvj`aZ j[`~І!rC|cs("-uh}@V%_ ^-XbQsc$ Z[?ފ^fk=u=.\\' `Lঝn̰3S1!ii#ZAQAKI6p:1V:,fW`4%1<-[ վȵݢ L V{]AA>k_K{K"%LRɯIF0*wH tWd@Ё9! mIwcyoQ̧w5=toXaШg|*L7}{ĵ}q^Psqm72JBQ "G%_S;z9;^.|Vy]mzu__6:{߁>st\V7ɇr l*;|*Ilqy9(NSx[c ٤t HqPHF 7# 3F@~$ TsTPuF5J+ھGsu7]`=EO `$CB WǢ ]Þ3:!GK'v"nI,)KNt)\" Ơh|?QkqH"fڭnKts/)Y^}V;Ut.#mvh=Ϗr}{N8y4g[f]5|k[f WMfȊ"И8\E6~H6\ vۦz~&@@{f}:IjwT,9A̸ !Y2ups>#%P:((}/gmPS ."r c ֠#^oQU*!@Q ay8 a ud$r~3V;qIrx֐:/`wɜF0@ Ex'LdG}uz=J=zM*?~Og{[7 mR%R#L(5T1*;ϓ~Dž{WӾRw ,u:Z׎2Bz6G?SBf^tX&}6+k( 0aICJ !,|T{gjg^~h)zS G;/6kJJ"Ieb)tӱK,1BCT CylwLUԊ?ZNO1:7B \46i{]# GULp4ob;[Zf3Vm&;u[fD)Z|NmϪ pKԾ_,ڦ59ى 3]|ojZJڟk<,Lf+Կޱ< o[ۏS&˵8tUt 𲺄~՟(ܿs6_KW.E ѣixj`yX?=UM6W ܠH춏)ѩf漉D퐊0\H -i=OŦQS]+b@k2Ide ZMIv-Ȭ# >EAU09_wB{ ƈbf}-@~?Z2Α:sW8Ol?d:~XGYN}~uع@VPd Buv߄ܓ(=G go9ܜta1߻xL1Ԁɞg$**W Ǯ?U彏 ʷ#!~Wi}ܗ o#ߏq? ƴk=!,ٞxAC)*x?l:yNgeкo5K7W"v(*Vq+E1=OzGsв┟?v d|.>ҿdI7I;\Ά']l*I?;o}{_$yNWx/mסxI9j]RLޥ ^!$7zM %2LH;u\۰{$3b@9b ƀ}OF@1@G@Puߌ^cq݂nx&oSsho8=ZM5m0$Ypϧ1pۘa0=c h :WL~ⷑ֦8_lUdY1}[ 7>Mn]Or0?̴mhĶh|+&ѻ!ܚH̦?HR'w LlB~ R,Fx]`™>&-TV/kj%"%* ,7[4"aheϦF{嗪1\J{O_ۏ^,G z݌(˗I:f1?gqz|idpr''=x;n_y|1Bv#\DFr =5wF4̗}T%t7h؀4 3{"@[MOJپ¨'ӅSV7X%AZSNx,mP=M:#@P EX2Dm& 0qU(\~U+:<[x慓σ9!w_a㤟gߣt3͞f[ s]6 Юvb0󏩯aɲ޸M?8L9#'{n4=5WjD^¾Q&DqZő~ _})C%+ kמr/ʈړa('0=_,  ɣzNY mAu͸pemIIqmoII1 0H?I ;_@&7}ύi5PVTbfM*䡉X)0 a9:'s5T!lI.kX]j(ewx^iʻv~"_#C 5ǽ=e}_[Co}'hԈO?5(y2LF:| dC6 ⃌bF$q%OC\-鿙J]>Z>M\,Pm gUMo dOrq};?4<;pQh!wkY]r?V5ZoFsdcCᣎ'YNU15)}~q!_HiaZ,EFD@Gk\agU"9-i\{ VGEiAVe+gVѽieGNT$L݂k<(D{U9~C7_e=\c{ ; + d;',0N6,S>x(1rw8 7&ҺHh:=mx[k2`'[wu2(NR[vT2:qjĊS-#b6SwI z֢^;Aauj`'vTh(~gB 5KQ_Bwx;b"g7b4VjΩ'x=:- }..y[zsX3yR7=|I|w*2#.ެdgr",?@lK.^DD(Du/|~tk:~" z#Y| $:>V|BAPe.>P0c)_ ?%_ae5} ~J6Q{>жkX^fZٔ;J#D'[i`ojܹ}3cC~F AAU-l*{YgsRo Dۢ .IM!^BfzGhYt^Fb~?_ ?ФgNsB7mPDlt 6I!YLw%2}Sq 8 j&%-VcR]U Vsz#p % ɍCCIzGȩl΄U߾ ݤ6F"|QzLh4R O ]F=z|8L2.Z*W/&?Z̕GwkvO>6vg{vLl^uRt_|Pʽ}k{KtmZЏyOl,_Zl6׋؁{!;|V&ƨs]홄 D nU}V9 hB{}x]H yciZp73)Vl]ŁѠ?8'B " Y o&՝v6L-ۨfH_<ަvNsOТ6,M|2o ( K2i+d3.Ĵ*@E&.t&{iDL^ziǢjXh2 ءV2Y/ߕeIoLIlpѵ&Maªx_3R_c,L.h_nZqEe|Vߧq8;֢{5rrC:~.Oխ EBWF$0q1oGLj1-@,e%V[ %m1[Ra/y2೺fS+v I)`DB!S !dsbs zI4W!1F//_W.7.e"kk2L:͒#4 0o>SnWi d ~E3zR (` }ZʉÆњz.r/ήmuƆ54oXcVԴ =d@ !Ğ "1"᧱/u $L.z')~p?Kw^Ⱀ8F aEd5@+tm:X3*gc+Y:yhZ=Y1:?RV`3f0LLAɾ!X^!P!dIJN&#L`cH@r.XDD% '!82Edh)nQ IC|o"ա;~^d#9Rad0A!QPl))n^"iɿğgp(eKmX .@RBBCKbHZ7%16 rP&һPDnO| ֢(d h,"M$2d ڕ¤yV *AQe%_CT]c(iǫ(@]+^8=&2q#1*b0|.FGei/g@0OGXg0ls  \ޡ7 Tɼ9 قy ,9&j=6JOKϷ'&)ߵH kLK*AZO븅zĊ6?m % . 7UE,r턣Zyk8p+WPPFxKA))/ojBz!lh^)ߘ혜R$J1L1I - 1|ipDxn] .Gewo\]?\f6]WjuܛEu:N'sU.|O"[Z~+UڏNxPȩ !'VH@3v5@JZ\R'H M&A@f`@DC&Mw+ nR`⍏hTq0uSWAiny7ڱHI))Hs`-@(qn݆:߁:>ɖC~$>9d6}oqk&3kGOu\fE7&XwQ5f'8[)L+ga$~ |R$MϺr'#c.^i5pU:g>oƠ`V̇jrHE*Izpv %sP/HYXIhoa'^ &,T߰=or{Kn"IA`֣{A.M86lzC/Ooϼk^23vl5T>h >F31q[YJw?- U`gh$W>I<B*חI=^Cݾd;ĴqKևiz΍iƹ:@U=!Qg ܪMяnڹ}tz[ .}c– _I n64x_a}y2z̜_pbk{'ϡ_V\Q6#6d2  "?:F%)' ;뮵?[Ϸ1z{=MMOe \lmCP]\jPa De0wKrib@@QҀ Lf6]+dX3I$]w|*EHq$8iWFRSf~?_sΕ)rTct[,v/Eb!F]:3kVY[zA9% M6W%zB3Ԉ9 F$5wٔq,挃fۻ4 &urw3`_gʔ]s,<4.o p)mWB*Ƞ||"<ECHel?dRlrr>#g8K|7?s xFq%ᔴпftRvWݜWz~B|꙲G,fh0aje̚N #` ̔Ho^cnwzϼP5NwOaY(Q :f쾼1Ywٛ9Й8^ *خYb7쵪z\+)dF !Cwmt1~uu<-M3bq:c.4zݖ5\@lJ, {#ov7])F?af eeqsO9GfQo>'u{cIk)v0Bɇf^9#eqk@m%9Z"x8mYyU/AAbלiꇂ{ȶO->ӈxu/otf_7_)I> 4C5hdtGDCnP[?삂Sv&9[ dlMM"S : b:?j䵐TJ%N@Yq uk+W9Kf ?0JjUI$?`07KЅ%Wjlo}LGO= Qp/9d}s[!@ BN0?@ G$CQT9/--OӁ8Ch˯nqP}nX3:'c/t8fSjW 3TVE2Y(E!:bX.%?GG}nzOJct)s.@y7ըQ@aI;o=whq|Ff! L} /D@L_:ۣ4GmTZrðs4ǻ11+yQp(lPvl /V;f z!^_i7\1I\$ki[s{L;ECg_<53]?>QLW Lj #K#9OBCsmuq{ qZ><TFOeMogvurqO=yCtd GJVB4"ȔI%d3H "Id&ae!4EPPHWBTZR"F+Te)(H)of K$cަn<,H[)^J$Ǖeaƌ?ȳ$@!!}/s19_=|}_II܉O`ѭ;28[/4Kw_0[:CN4  ېfv -D}JRQ\OM0G4?QÉkL1Go ݝ@9r6=j?zf썖YA?iٝ/kyVm]3ΕO68_!}"p3Y/ #G|b4}Q0F7m/<Ӎ^ᇫ`_\ sv/tUo-p00H״I b:ҽfĂo_׏{0Q<ָ8☱|cF^}`aWL `E0),VN~M{w9-|[B;[]n8;aq>i'_Bc޷я`ǹL >9<8w3[f~Cm4.B<9"`D}q=638Mh}"N*2#)0|80AAHsEޔVǧY0wC}^W^8DkO\(9Kxz61OUo;Goؐd_6Q^}lA*l;X[p+eoۂ,V0bo ( C(Df53;f V-~_"b5`(B+5w0YuLI6"7]$P) K=M5Yk&3 .۳S،t9}XnQp6kpXa'"{^Ө E·/NDU#>bL~*R@yn祢viFc4Z4 )# QIzSO2snt43_RH9G|d_nLI) (i 5Rksnn[_7Mc&Al){ةR%}y e@Kr"m5,o#vŸW-?|ab; yCHʉݸ AniQqԷNjox_Em C١}E)Rř8Z0ːfkF)JGNdь" IԠbceD}9\߾: tU/X;|Zg CԲ5O &NOj׼䁋{*W9 aw_/S{N=?gsity$ VA!Lm'%U.a`ē÷@INARv 3^>>=/I{9(vȰv}_ d ]>g+=|NXZH=7V YehX=|yvmM15>9(v+}We9 GOqo|v<˺n3%J-"Z ȵ2b<9sS>|{=;[3Xd"Z{v"BT!آ_5~MΆ`N%/@0x0h |Uhy(r >!`>cchRŪ?^ #U. FJb ?66l5g/7:9fp*jOnnKfXo>/$ˢyZ.w9Ys k:v U4?JZ;_]M3#SP]4U V9j _! @`.Kl&U8bFWԦKQr1r,a钑^EclӁyR9YdJC~30z ڭ"gP-Ļ3oő&{~eu#DռG_ÙDE( @E1,=ᆅu}h㽔r? 2ڳj,n;2e5k-]pAZ((M/*B%-XnG JH;jW-/iՏCّ(]Wᱰ@J*`9u+=8i)= %fc0@U v, ^9}^m7ˎʋW JKhh9XI"-{qL 7Yɖw3\܌f–p4ŏʦ~g|Yi&dj sꨫ]w4oZAs3\b!N_{e w~~V{`m-{993h(!j]9;cY>i0ei E>iN=˜K6 YQ =ʋ[`|uNE"k˲DWшuF9@ZS2ff JD&o&8i طWjSj6՝1Rȵ8/ l,m)[S#%8CRMn1[#e="*}}ٛ5i;(tQTT!2D9JV'1ҹ(I2b~0ջt2!ש^l2i"eP[W3]`}%}+)P^Wd[+w".eBwe8^I)cueʹ*)m1Z'O!8Ms /GO n}XSVq<7uqGq&3>ԅ&>n$^``Bf~&9}b$[3mLJew7EaP(~k @k8eL&? [kohc/[j$?Z@⅘NŹPP9[ĸoۦG}Ypf c0Hn300^MdpDB!Sk:(V `&nG?n`|/ %g29uTS }k,*_Y.L)a `Jշ CAy&n^Ot0HW wn)q2e~;G: E =S.wK$3[]A|!a/ o(z%}NPZ7t;` xGаJי)Nz2`2?'ް4 :{S@0p֎uBkaV;G3tr3P{qv-οB/@ !O]$SjBOXú “!) Т6/j__A3w4D5wkvîU݇mppXO)b~LJ½4$tUx!Hp,\}y N>osꗭ+;Ft@uFq6ޞ*v/8iK-ڢ]YbwGYֈ'?@2C= sqk~lrhtwQC"p\6aj6l+ *<^Y0ecYMZupȸcDTyfsS2ʨN1e DuC5gUSUǛ"UEks(ɗx8[>u*lt\.ذgQN4734fM̉ώU)BްT3\JlL)#e ɓ 8?݃"(OlشDVb*D() Kos~+ݲMyhf4}uOpo?W"cT ~+ s﨩Zum!em][wl 2IJPpEw Ğ}ri]ǿ&ͧ\OEb^Aհ~1Vޮ: Z}mnՊI.PB5\:inF{ 3*ըnlnzhI#ok`{SB".MJ'%25p&v26:x ؅nOַ/[wAWm7v!$ؠ7fT@!xҾ sYڠ;U&⹽+w6!bnqjvđ$$ --&PXP Re3jU.|nm"a-PvMhcpgPFM9L(V4q -*Y\AGCF,I>Fl@Cke4{Yr5 b]\LonjmWǯ/xi"W"X`߽2!4BKǾ]㿯/F"19 - PhZ5VYתY$ @.r_؞o 2$ÃW4 G SK$3,^B uxq8;9cb;rV$Jd\SJA0.dr 23>kK_~>qHbB'a:q$6ʼn|W9u.kkI+ݧ)Q9QDH !(#>v{2"Sm)i p!u $ BS&PD-U!}AiT<$t҄׸ y6Ɛ7/a|6 ^X&(mq @g5Z(`y,_yp JwHT5N̷SJ&\&6jx[QdT0/>c>]~ӕ:} } 5pOiQа׹SjnEd oρ?6px\N?=|m}R aե]:-! j (NN6v|LG}/ ߸KIP~&f,zbѺ5hr' -<3ه߉{?ާ?S߲lg(*146բۿhAc&_/ygU쮹/F;xyOŞ2u a"21ڟ 0PEάyꞘbH}BlqMJo-O[u?ev #~J do32ػ< i7l`eҥRVrd% ,b*XU" DN,+h:yxb p0(,6Ȓ+J{[ ;E>bUၷFTg5d)D._ɪ *"$eƭltq +ǂuoOĝlVI{ZM0R@D8~4k/!ZyOx wGǛ[~INwe$ݚHa:<{ H2$O(dTPLl7Ou̞fL0Rw9(>Ɣt?5+ν3Eb!=(Ղes7clovtqUɤ0 G$$kk1-QAE[F"4uc"7xZ@oݮQغ.{J2V\O;l$9Qrbcz1OEyCGB ڕӲɔY%'B@n!zwgsA3јPgDH Zl" vb>Qi"^?D5p.Y&P"<4`sfEP$,p02lX;wӳ"#u[?qHm+dH!,q#a @DCQn}RGrAAHz#hݫ$\4jӧöw{_{p:E,;u%r097_%Sre0H ]Nj񄘀 Ąz$ qKD+d UT _i[\շkҴܷ@WvV'99.W_#{8yucϙ^}elfrg49}x8۬{;wbH V+JS0YQy~h!=uDxxzHn-ȯWqOz$D=%(hw]0r`Kz'+V ܡd%&#_H<#D?R?764$[ۀ WsZl\#F A, [8Ou1R޴c.wJ({l}?nR ZރYqe0Ӕ~P6wp9^}]5k,c/ʀJ` 9jo?CsPms/gFRW_`@Qdx_˪V MFJ@vӄԷ!J<~]d.x@>-k`=bWE9F"Yf]o R\8?bsjVD0oS4\+ckF'Zj֨CTVg<'Hy􅒯Ajd@Ĭʍ76(,_iwd3Kׯ%>fdA@#r<=Dø8) T'| *!D}ן^7ՍF'n /g8*:i w?(L@oEi8T2 !Tϙn7_PPq,?%޶>e.3 ul^e=ri`~7޸0`xa!I:J۔ߙ[mkVa^*N6nIzy*3!JӶ~L5Š(aW *)0i{g|>Ϸ3}M #!,'10ȼRdQH9 "Z lc SBBå I1+|m|o}CBA0 PșnZ鿡eQDzrķ;/N+zs Bi"Q0J $K" a1/[nBmI#Gda?\?/6qM$Cd5w, p˶t`?2$W2" A liax, xXrN;/`oyi #DikmNg2&n~ߋ^<<#fstM8q18`x BĿ˦4VlyG~L_ׁ4X0/X_˖R@|y FnOWevKIڦfe$e zJiM}MNTUR %"AMh|X7%)DŽ9-VQs4h=>is ;T`>vU.~Ӊٯ7crO˯WzG 9ii<}j\bg]Y_#ACC<}_XI^_?_;{׿c/pLRx"2k/[[o%DxaV~ķ71]> bFOંB bW ~ ,D9:&yDA13źE+-wV5N0 v2= [z~bnN΍`ݰjT&~݂?}[7{_N@ȇEXBUI^d!stn6.y[aʂdDVMͷenJRbU@F}g}G |iOT,u?]sԣ @+K7Q/ w 8lI)d m}yoiT/IycŒT|/е; Vn MQVOQ^)9F<&OX/64h%B]9n۵@򮈪XCo0r_b͝?+(%"K"QI|Ġh) 5 }6ҵkS'>r  S؀)?!VՉ{a( azXZ~* epI.OY_{$5N۷XuxS4ǔh:X^ccK馟6i:!=(F_hS Q]  \aA:J-"k}vud*h]FO*ޚNSH\;q?HJ.yV%;Y~IoZޘ:l ţnNnv9ԷX֏`b?wצW9{ bjYb_QGQ"uRගVݷicVGF1Q> V}2{A̹ziC=:[ jr.v8ϲ(h$&o2VSLQFqLNCPZeG JrL,;t]~"UyY?4j-Ri? JX-f ʬН;#0M6뵸6u)ҢxaW81dҿNP:feŒMY!5u, zZl[4je-ibb\~#I;>VU eoʠ8TaQe֍dUwOZ!YQ ύ}3I¦"6۩ZIJ{95i ҉O[?ܦ3:Ըܘ\@BOamP!ԒfHC6BfI''4S$?:wx= @Z{LME|bE;XNE}[ľWG[AuW˰]q^q6*<,ܻɓԺP* =LY@T8jyة,5g֗`Ʊ{r Se5+VN)abf &!e'.V{:X +xeu;!vݾN4ف* TYN=X@%m/&jarWladIUrnw7 f DԄ2;34f{ bs[؇`ʹ׍/rP%,~Oхθm6'.Z7hsܚj>|: 䚆&5Nz;v.P_ m*H76CI̘zUF{YZ9/||׃pxTauUjj!HfQc&XVj^QR(;^]#`jܰR.w\R1) Șwyʧ_ )91*bGɊ i!|M,z= 3nyװaJ֥(%(*!ͽ 8AH#wDiL\(F]zg%DxGԹ'EFGG'o__EU;cfcx`x2㣀F="vy<Z X-i4|*{tSj7LNT7&d/NI^pZ0WEꗖ 4|e]QIᏑylwOw;w.P"Qf)ufhZQ@ce+V3L毗eDːzH խ~l ox*qd.WgMS4.Jpz~\͖u Y2`~j^R~Л_z&c|)ܘB:)a2gnvb_s_G6cHOM³H#TG,SyT la̹S^ѻjK%< 0y~yp`jd4Äs% \%[R&G"S iGiE!g”DnlXD9h\c&\7YӴfbWV"4 K@l;i)-6@xQHO妰SHC-zi']c6qsR jgz ;=rwOF#~[]Mf{8u67Ϣ`x::(C)"jad}ZC70&P]|+߃L,YgU;/$tO7w0ExHDZkGIOv:k1t[]sѻMU&kb&U]9dxZ놄N„pdHTSH_rၬ1HC:uR"nԹ6b-NčG*r:ܛSطdҪ]ͳ;FU)ZL4{9x$uTY;gA$.!AdXb[=6&{=8%ud7piO{ͣn';UT:;|/EYkuP=)l lVhȣѯ̦iG'{{V}LN&8%F-gXXͩCkcL j/(Plri=ʾ!إoM>J/Ȅ2hZTb¬K2gcfu,9lᰗ`D \Wwtk;Z1kqٷ"l‡jc~lx7pLpXdhK}ksX`F Vr?ù5oGEi/20>!~BӢd.;-1$xlyl~aM*QMy N&/Vԙ;Nc4q"4v76-uT6tg7&6Psq5d Z0me%l*ѱ7-yE!DMrE͸[ԣMrj2&Hܥki̫HAU7c.gnd}BEgJ4td]?Smstͺ7ZaFGcyM X,~410vVTzNZbo2nw9gF8σi}z(bxe̚kP Mv6 -J{.sYuZYe8xtyo:)0qی[p\{pןSwwsgX8nRUQq̶F馞;9̳bɋ٪\9woeoT@p:=sSUqa(Z! GS"Vut'NXTxg=brrH8i$daT IP+ُcmμ:Lˑ,Z^Ԟnik,a^rM)D:=W^sPՃBZȱrk $#?S"Z&2i7F.q (A)&`I[DS(oCՕEZEdQc!ajbbNmV:Hiiا~|\|ɖBz):huF0g*h^&˪ i6qNp44pIKk+ITdjMf2974]wH(( 각Y $! P2!g_q`^|oTӎ M!HJ$]e0܇As`$C܂~ZG˺ !@uk [zj;a>1Ϳ.r9 E׻Ny*R)5BD:r]m>u:v:F·L%(9^ؚC:}M-I)ZMU2@W㐏c'yS+Ӟ?#]>%)ƲN>t\~Z-Pbm2|j_@o҃ s":`hݶHMī +ܗw>3^-.Z8 [% A f(S[5 xz EGLn_5Y8wi*cEAB&Lڨeײ9N^+K?[@MiG yfLEeg\U>~z:>i:iǪ-Yf\)H]8{lSLMpǶ>-6-}{;^\t2a2\ (4j*e59iүFKIF8 DA A5FtLz<O jRZ d8er`I,o&3~؄uMSm:q.esʅS8fS;VLg7YthbXUQbσ;or2n\#I<9|Z,d_o[!a} 3vH"\\6dJ)]4Dۚ!uXu_QMcAY]fZ3bC`´6NJ7žL^w?4mWa:,,1(kFBm)קf̆ۀif$og:֛Fd,FXW /dnzUW{TB*EӪN &$(E_j"zJAIJ T#AIѤ=ݐwBkIiWa?</{r?95f @ /vPR/Kemo03;Zkh*@s0P`xݟUcuDWݰ{۾ӨX %) z6mODpoAJB(2HuQ47 5|ӹg:-on2o^phXg*@/~fl,+C$;>᥉Co_?>~@[D@.Lؗ?P#ں " i4b(5/#p`ԇ$IZ}5P=?/_.6\zT4ܤ痍՘} ;y6@@8 4x;J1A/"0$hY9Z\35#QZVBiAL1aAx'u(EF w؋95.2#=&^بڂ27DPZ qpLUzPzg LrsŐ?mB.JLU齾*,?rTF&!>"U  ESoNQP\qL%*ң8b#]a}ڎ4"̛ڜ7j{ڊ2]'։| $[I] )T~\aj %a~ٔ$]&,( J\a?cx}L-"i.tKZIsqܐkL|愼OeNyfϟ_Q%͘ϫ>oRrce0 qm00]/5桞c"L~sUx{O?8}cN'}Ga@0/L^`Od҄7;`x@e5v8,$ 41:?( `kK*W%ͷ,ۗ#RHԯߘ_y(6v;rzq?M'axxxV5B"`T672b}i#tkе.֚v8X{ 4BJ": #@zks?gs/VelA #8ʄuT Ȑ$@" F0P=侳Й4H ϪeOZn1gZZ3ƴh>1!wLW0ϫRwˬ{?uV{ 3}/F!nctf0 Up`(x%xdn8Gf*-&.tvaǕN}?~^C,D:jSQNm4i@ B႑d,H# >e,-=oʯi=۵9/38[Hl",.A)IO|^}~^`r!C圞/[tMzϳD~wMk)^d,{t!,J-pj> q{0t!@M'+O>}޿q\)hH0Z5 B^|BKdtso[ld:Ixt~½w5v E/KU+@^UC="1yo6[/2$G9MyJ`LPx+l Ŋcb6knG3m(lR}RŦ#GSq?b{j'PQ{N!:u :{Kdxr!1(\3Π40(kUVԺ5w~}{<\];w_=~Ѽ Q*?D4S`" U50(}/"M._dR4  &T""( /E-( O :MJvHHm7CH(ӯam$f }7ډf%U!P.`iK ]=e2swOUu ? 7n3T~fZ-f( _S3P"qQ0&Dw9IK|?qr=~gg0nPlŊP`Y=?1zouF~w!bp%Nn()(KKHz&PrH%SdO)-D}j_)!oqM!?Ҋ8鱙CfE]bx>+Zo E)ۉӕZ D6];s&J*<>̍G T `)j ^y8 :sx~5XQ~R}m΋uWͶϸ|jw~tAkĻ 7֒:')B-r 38vϦa׶w|>֙ Bd,bZ0\p]+] okR-2T0x:?Ls~Bd{lG| C:r  kl]Y;W>zsbۯ.m H9>_\_HFekM82 qHg$jm5BE͈|m/%Ǡ )1|Y6A1&N fūgV?sy*e~zop?fK FJ"Д3]]ż\:+}32›9K26:DyQL!5R pPLAAx{zUP(JRpE3> \vnoVzflYJ#"|@D3DAK?.V%sT2oJuc~;OG L,-X~+o_TImZP(@PBfk5ݣZ$ ^wo*T.Z1C6c9ÿFzs8@+&0J}M] 3} sBȟ͂j%Ů-vZK/U)LLѴ뾛So.js #͑!6(t*b5tHaJ41oLJ=*$ü4ֵ:HyH9602~;:[yz>/g\WPa ehARY0~a9\߷{f셖!Bh >iLD$mF\4Èr JFDm60b"B2 i0M "҆SD"M<:`QE!ӘdI>5N: SQ0Wmc,[WDHgg?? F 2}b8[Ӟu^$᠏ؙ&Ij6E4ܥFa+fGcAxf# Z#j !}5e[RV5>)'(|&1TIhRl3&-(z<#()WHO`i%2tPo{ooru}vC;w]=7lw+֣TFS;?ʹ.w/be4*#(]Y$07MvDN"d\HPd+F;Fg'O+_X~f@U)Bx{Zؓ\jrHOoG5i>nΛ:˜AX!3!wUWkwÍLOl xź$5SHHa'ӭ]53ng[8%_1 :PיG" d0 v̐i):3`3uU ]UAOzxe6,&75~п>? &(@6Z)Y)퀴E:>0z_o:Zthf-h(,Qa զS2 zȱyc6Bu>[+@=s"=Or1b8H7<C.^QP!($DmTgd a E=ګmk&??Q$.䷴p!ɔ@]^ILZ#c/OC L!# .a]/I{=&i'5dakuRɠ&Xv(CN2&,AHb4II LBL Laaʄ RMd7޴$&'5 $JA"PD2P *RD4hmkD !ў0b$A{_h9XJ f0kAIUN\wIN/ Q+$J9 *v&@|{Ω)io S$M:BpB+~ Z_ ѸMbw ?Ix[:u=-נbGJl]ZE @\|ωn˘#<>!@|~ !=)*l+8C+&qT)A s Ne1 |C2ɓP%s:~?0mז<$$CP06d'α{ƺ-krV=tpX(k B,r^AyfE&e+խD3U4~{IͶqT ?7]_-XbxrNSИds#ڎ"0A|$SG*F7rtUB29ܼ' B=I, `'PNc>Y( &.%ӴRr ҨLV?e9M3mO0;_s{nǟV9Q J #$nd}x'[K_bS:h2v~Tf`ܤAa^|r> V:7FR 'j<&U?J[X N H(IxɞatB_K)a`8cH ::6qkXyPfdf\I:Ȕ_\9v8Wd2LCy[GZOV=9`J _:H8dwbQd{*Zc3d$mO<6{q:N|ke1!E55jewF_q_JR4yplX z=\q?O V4VL+#}}v8Qj8!ؿj2_Ҹ8\+p;IwN32oENN'T(:8&Ob&ep*pyDF`1ݞ5uo((N1O8c[{D}{i 40UklY}++)S~$, 4 %fOgcO'nI$ӟzQ"Huu Zg8f۳!nD@z6(yb: H <ٚ/0:f/A^8km$۽ӛܺ <( ߃?R msy)K3b Sd!Q-ɤa ]P仱?];*Jԥ\wL5 ůMW99v#1@𴡳Xh;x4r /SVeaku&WS̰p+1g\)W>B"F"G yI3m>'XUN-q9Wi5~UZD('YS'5h ίNC83aLvjJמ2ZYA|ЀZfV-P,WNՖk|/ʙ. a.Z]>kwrtct 3OK[_6AxHE2Zp JӬ /c\& SO8 Ly@PP&lKV^neدꕗ 5(:1eVTS.{7VLrq0quv&xiqcVKcI6;njv-&c l4$;;Bdw~B[$čwx͢Z?j^M6M dza< )6VIKym.ҿe64h/vkSz &?qq u$<^"b(d,#'x~υj$z+MֻzB%lH9Y0^՝Ȱ;Hvl B=gDOo%n&,/%X->=NC1IVQms!M(qLE1 f%fD6B?Ll8ESi=͂)KW =&苘sCKܜT\XVxjH}G+ VVj0٬j87ɒza XLG泌ˊjn-4.h:x,ii6+Vs5Ak>kkCeƯg5j5O&tmw^#|阨馆enl }Ӥ./u(Hd9˹- QV꒦{<|F/C#Pe@v(kh)cs%)xkT_ˡ9b1.4I2!JzrF!A~ԑzAmL8$׎NHƗ%x8Zw60T,"),#H1c;+\_l;v0`anvf Ly{zwOdO;榽c ݿXf1;jنT| ˵}z(HRk4cFef !-}5'Mv(~nEٍxkf y/ϝ)!d'x>ᆉKWi; ´wxà U-Lr!Ҽz0CEޜV`zK),>ll[緼s\y3 up|X6ti\۝N5+o\eOrTsL/gIbWCI]gFa85 䡬s Ȧ͊M]bв&]oLlq nBBl7;xĊphiLTv#1+:h󺇶R sL>| 8m&g%47!$iVH4Xɝhy9 L 15LB.D:Ϳ1;1*<}t`T;Of^<wVF^RԖkc\,Yΰc$}y(,Y*jGDJPYbµbΦZÁ?b!}ӵZ7]gKO;/+SՋ/{Yv+q,{N3R>I]񠅤SuoW$ ByZ|",.;2 U3%ekvqkUp vOӎq-KjHtyV\[|yR4ItW7E+':M T6<<`e1Z\T~?$Q~GxWj?%GظK9qj!>3F&,m3iǜ崐‚#qX!$5 [¯"1R17,"{k"7UUI@A~SdG&ILԅڽ~Zv (\i J|cbyE&馥 ۜ!QV)Ӳjggk@LG*.J0z%6G jjaݦl+Ip{!5p!CL2;Q}-FP8;f>Qh֚$L'!$B~g>9UCan6ZKRM5(UYu`d( th KŔ~ݤD=HdݡDD1e8XI̐[S_E02P{(dG HJIB$BH]iyR A 0E_=}34ؼ#2 Agf|^"K?oj! XvOo7yڰp`7ȪkHq^C:>^aVrHLOEs `4W{r8-7 H(yꎯ6_}3'+?\'д}qǨOK\rM|$/`"SPYuEXc*sU&)2a չdp (L` M 1LwC$N3.5->kduoǙ gJ-.h@PU,_]_m¿f1H B2Dd̗ZKI$2((+RBUM:ec ˺kbY@!HB#3%$`TH?ș?`'Ӓz` !g|y\2@mTPvj)L- g&*6..kjPkz^(ٕ}a3yV.2? I l~ : ;Oۇ8`-4IqϚh "Z]/e| ;&(L؉1g35DR4k>ǚKoysVyǗD|uehWaP^WPt%3L 7?7P B! E$X)4Bwoiy\w[»;t/6d?hE3O,8zg$)C aR^*}?/\ dI'4N9LS%x$2A]cl}Կ~̓/-# ˂ɄR^F 1^-,'I_vseI*y @ F2Nl!xy&~虰cSMbEE0r@s0`)fepbY~RcyMɔGL4Sp-VG;# !Atރ=ury8SKRo3_S/Բ;Дd"@8)rx#ƁylySQDL~tʩw~d=^HC4t JY$JG0(Bt;i d.Ϭ9Kԉ}w=}$ Q) ?~.淺:.MPx}>lItBL +SOGP_Z "XfW bx",٩bӒx/=0'k /Q= sx¤@x&U:AE0G_aC1% ȐsY9Mmϗ4 czC>xҐl7<6-hܰde=ʩbgZn/KzoqxefyU\.UcN@;e:T`a=lni>#FWAc0MK‘V4.G,Z4ZCIcc*- 2H!Cte$v؃AC԰YR1GlwJ3q1%uXN9?^ɫߗWıӾ=^ObIѳmYMQj $ "sHh F,+wϞM OAk|c|>$) "yHKB\Tӛ[2$x1""?U-b_N\~f/g.s[} ^7Չ(9 <1qĢī1]!n^j[ȷYƲSLMYDo) *Q91}05v59N kD@gs3&*ȳ2ڏ9߫)ڌ_c#yz$Qy8PԮ^Z6@$~ a@,~ "2,ݟtƓ"(X,o_ ߅u^Y+Ig~L3N&PDtJ, ܄(7!0X5X< ,U'؆>+8Ql.!4HqMXT+ 2QeLa9lHp,aVA-rR^ŪjUQH" .Sr.$؉`ʱD `}PQ(٨Y@B[@"Ae`&Ec3#X>WS5%!&OiPif]9*NЗ=kxb4geéΖ#({4T+ U˅+EvYKtz/GK-)뵾Ik+g>Q&F{ZQS%HԘ4U>gs]lph"֕=눤_gt1#3(ܲ$r</T9-.//ƭ9,5QxLʁ l>ߒU^''M3T dP B ?HҹK;4I4QZe..Z?ަD ʙO& %y*,A'1 (Gҵ7ټK  !jGZaa^FXn _]&:|$2wS߿Vكd`su~'^AT$#Oٜ@8;0 c%v}C/u/tDA:B- 2 n*`bNElJyg4+6Ob^O~WH n- !k1ǂmp6wRE(I7T3mUZQ%i!XgO[z8*,0!1R9P^7/w$bݴnqQ"22t`+6?$ʎV'!dqqZ}x_B;5NO2,߸<}pyd[CDx0{40 G).%+bʒ$M)<F&ܡ4J?hzn0bֽcc,7MS1u_sX|Jץ gK fAyk|kCCR?G/q!9tY~1Z(T!eM&A?w3+ iizە hgt4 )SDp,6O?7TcZgW~Kߛ엉@;GuR=QqJ%3+\hrsEJ<=@C|P0/T\kWCFϡR)ǁp]Q5So-cA3ۼR wŶYXtV%"HH8)X-Gش; 8̎J ~m 'ƀ B!_ n^:qL]q,3[I*mJyW|XVޗ%Dc,͑@j ac39Dh` b²ݓ zN {AMv&6ƘBQb8X,mk$@3ԯF d+V: [IX]b$^zUJgĈ&G*?Aye'L "thM=ȿFW/Sɬ>:ui|aH,{(aGu氘8#IR>OIЖE+`/?4\J xX|1 ׻[a~[l/6jeїGw"#32JNǣOd76yT??0R1+5B[ЉazJ؂CWCD"U?Çah~0o?O$$}i: 4 O_y]qD`YKҳy[|XXX R޾Y(W+Ik~afdD+vH@$D ?ڡ@!C>wPݴa5"Q \S `Qh=J3C4Ch?aǽAX~)4 %8F;Rh(XtT2$ASM4X-y)&!2P Q&P&Yl%D"!2,(LIem@YD2~溋\2  |+=FGj'YJB#,dO˽{8R7.k(9qј5ٓگx翓uoM 1ѐfs+ |۔(t0,YňI ^ݕn?~`?f-v o va~ӵhѐ)UhYt۸('˭c!c?NS: i+qٸ_AHM:b7G,9<{q_ٸNk~TtjiF0v{Q^)z,n~B #w@L>J@ #]H=·dT&:RT@F-Zn5D3=vCb}`̥M&7v'זH ֳ8lc=zJtyI0a!`Yލ gv-m f9i_OF( |&HЌ" JPlJIaĽ@LjRj阓FhF΢r11!_)gH0-:3iksRmj5LI3ҵ7wztoRMv:jR'n`ޜc[=%혀%f?Kͭ=vDCd>܃Ј 'Ώe|(G*Nd7tu>Y?\ SG:FߔPD Zx1lU8V% >\ S8.0w wʔM{?@Fdxö+Rd7RuE\ OWZW[yM! yItRP,, d43Gì*1Ѽp}v-Sz;/yQykU<|. ݊ m@QD1".AcE+@/A O6p!^۱ErvbMqKrb$RKA d{cc;O=^KR)EQ*7><՟M› ~'4Ƽ*bR[7,}į=G)〫?:*tZՑ ߠ:VQ|(D? &/㖲AR2L9A3<.vgwXlp %Bv~"Dw5rQk6ES潔5{~^B&2`v/ޤ#|]>/p @ܡ$(`e`V⭉po }`AB $И9_xvo Ȱ&^׏l=o+groc`H00sI ӉMAB,//,$eq06ǎK<ݭaVkPPUK'W^yZ7 RT'P 2i5 C ƞ,D'ݫ+JU+ ) $IB2&̢͈?(@` S "A].2<G7y D̡Ĝ( E,\43f`ˇQ" QH M6f4# JΩ-Bޘ6JPB_uUieH#NP儌D, ؠA3{( $M6a0ǝ!i}cl EDKtk H×Pp#%*^{;ws"NY=zN0j)enՔPf +۸y]: ?&Qn$"<!9]_~jzoYr=X,l)k(ۖc[ȿq>R Ef(r/u @d3-wDE9&MwNhDJ z:)y2 dD!4L@ؼ z &wSζlY<$ 8 ,J206Pݠ8^DFg: 3`RG5K~# DQ'sBX""s^ܝyƙk@&gXfԂ7gsvXd`}l_iq\#UK$t!4KCpyE6]&`j[[2J6ے6qO+ sN iq?U|ĝ~z[H\}w |)"XqY9XY+8h .Υz ][2K.ޗ oi1]Q(,`pDmp\ .QU,TUlQt(LCOL]? ~,kc AeRn& aĽPc[\#Uҹ1tzr9_KA LL',g,i)ԒoŒL2+FDe՚ sώtQI}6HJgkȧĬYeQuC!Vr* x$c{aDmPd\ȥ9 cd-TIk7-pW*I؊UݍnGLE.opQQTD[36)X;% 6""*s47h]!# 7+eP0T&)zݥނ=y<T2|P <ב 0ADM33TOfNY得 (nŚ׉4_Q@PNLHKlcjx=J'n/1 j@IJ-ڇs0Smʼnذ) =ԁiOGA/n{/hhoV"<:9 oLeKOuw ebgNyyTJ&d ?`ؾ%NVr诫!gx8 "c͞u~@%5OS<_Ā)KBu6-zY)1kqdBH 83ǩΒo}/評7ݸC'Q.:|Ea |nL-FQz#ݢGhhn;!!{C7`@ʰ1z^p*p+ =1@)G[~k4½B" `quaǓ}\X59޻Zrq8c^M\YJ"]er*uX{qO:W$%gQe  wTӂTY=u}'c.GORL] lM|u~[ٝCG-=tNwN'Xdx܂DczZ#RdL:ǮDd2kr& t '%%(9Y Ղ֟pcH"0j[S;^?ᥡzi$ȟOY)*YV~6ڌCBOrvQw{\TKĖM_MvʩaBm)♠S2 IbنĔ V&] ^̾Qy9O9yl-j_=wuըOŃ}\+̙:g-X#!(GeoO:4u2DM_xƓG͢4oг.>T+b*ʹa\,D!I̢3/]FD0>{^6rr 65#o?֭jK֪12(-8m씱$*͓}u^J~%TgF>_;=׽y%-SSAUt.`to]UhO2(=7v[K!6._`~2g#p3P? )/1;1q~G!.Q^b:l5՗ꢾózlp3 qNZ~EXKR( pUקbRPP_ /!8'.6xT?aw[r 2jHM.g_2rMF]L` %Ԩqvoan 8PR֔sfTW˚PhUǺ)EO}XzzrG]#ŋThd34A #fHO$RFt5FBPn1`_cp8t?_UuYajjTr,n3*@o>;CSqF2Yϻ(+F@L޷e~K:Id;C< B0 0|*vEFzGDTq,ߴ<#7wS5Tē9N/n;:SsRsJE$9ߙ῁4|/F_pab m:w!?_1~ Y5ngn4km% I8|"= ,4"C^կz?Tj&N &[>T(@զMy;1E,R?fé P2VP khY&}- Ƚ+J=YXi?|[T1 U U6 #tĐHIͻDeiTMWt)^@ Uư?[ٗzĎrTMX DNҲ[3=D`nW=wDWZA k$oN+_+dzRܨ\n%k0ggaO<q6%RPc+9Si{n֒` =s^m?˾JWU=sA# [1g\ucȫz4ɼ&M&0\~] 'nr޷Srՙ%OED_&,sZBLj3'u7 44YDkÀ1})Ӫ+њNr(v>Nobto壆B)AJUh@ԥ(+_^Qւm +1 )|6QVnʾdV(eMx=z1pz܇}iTU{7&4nmձDY;UO  YaJ2n'X.&͇bbyv"S(e% d1FoFtgѥ,p߲wf!d 7qCPG>)8 Jݜ&!#Y X~gH3Jx+K_%e2.QEf]=KYHVEB,[Xϖ|5gMV&9|WY=6,uH b-B.}?>1B$asڡ+{xGi$40Fg&8Y=m^Չ+oEm]ZBHP,!l}"@4o^{Wչά 90W~x ЪU:ؿ};ԑ {10(!&8_fH(HZ>oEF |"4,e  !ֵRB%ޗ1z4Qb+ٟ6)?λ4_LLOD:vӋQ=Z֐>̜.ٽ]e,@$3YA?[}Q@%xui"IJv_aـ̈;E1˷n_n_M3{R5_nH ! RjRJ' =Y҉.Ndl녚AH#vR97HIK9:bd!?=x%Wviw#LD4hSp[r5l8VjPSjf,gW&LR/%7q=9)@b4XPn/(R74'Ғ_A"{(S 6@T&rw}Ay -52`LM @)_sB( ʜPS\$ϫKs3>}C8V24$;$s&t9T̯r S|N+\ L5"WWi?h~F猧c%H ̌M_c1zY[=o[oN<2nYX87;(k" PdɤE0µzAĿ..rR aeQUnLz jI1c/ULc$0WŸrF`{)qJ}%cp8ưaBkLzk-b4ț|#I bl'[:j5ᒁ߇U5FW01>:xlB5@&)~A_t_i'[){l\JT?,j? ?$;_EL%Q.YJqX5{xqоF$`Zl%7D,Z`ulۑ}/AB)-Vm*ƷhҽH"\ ne( ;)s&H' > Ȅ@KC#2)_shᘖU5wx_yd/Uv!owGrtwu+Z$p &o .z{ur_;sq9˾ ߻r{׮7I@y*}?c؜L_baWܯ#g4/$HBn5 ?~Q# `O8w]n0u2Qbh޷_.d}5e8P}]:_d ^Q`L"Ni𗜱0,ERK<^q1l;Ubn6O 51j!%!Ztg1f2eRWcxO , p 7$h:;ƒ(畜(fvHleKٕ7 N"yv{jz^}b" 7zbcwJ?2iX@u{n~g&"73#d%ʋHrZ?9ss۽% S:-|h3BņNlz(k fbϸFsR9"Wd~DFmkø,x^%~y1L|)p9=bn! 0w`,U@ *d.1;P# JӠxj΃sY&X)JoBShmh,ih?#3`Nchd\}2%(-kOwn6HJ-ÅH;i!82w|sYw-of{b`y <6BF\{N^oQYCft}=_ݿBC OC* 5@!rpՈ~|-NRdXD8lt[ٍu͸&C&xk` q>_*gG~OC`F h/nԚ m?xV J`䄰񋈗En?Ч]o Bw$ă\ʺI$w i8f03R)(+~\aDPPXXBZN[@0B#ę@e%^]{k?7=Ƞ@JKȐO&7c>Oz|tW{r 2K01-C0K~@rBi9]~ HvAt@Dvk|  \u+51b00Y彊NeՂu*PUbQpP2 ytiQL}X/(ϮV'[Muyg?¿y8",7 %h8`\SH,S[{Rg.ia^OosdYht-t9 j2m_ݏ!B MRԪ(́c19 [D8244Eؚ56wW_lbTC꽌i$wbGȀLB!E|(޿go_µ|\8olbCP%;vɈVM)ֳvQHGy qX~1BQc87U);W4O !P9@m^ ~q@[qƎ*"c>E+9f"BtkK^F=:|h-#R,2O%* A5`ުqw!^3/4Pp[lYqyzf:+91 vRj#I ^O=Ze{&auЄF8fs3ЬW,B(7m+n#Ԉwt:r=ҔM15L%{#-Q]zqk^Dv' &0'e6$x wus9x*c ݶj$ IY1+zSi@o4;ڭzn`\ /g01]CoDȰNPR=ARsrXXCrPk` BB SүKdaޚ) $BVe7cr#yThݦ-i$9Q^"`q"e%%Z=&4(%Ś0&>lT/!eʇ!_{"-'au|DG ^qLp"ٞJS)Jocr—UۍMK >E0#:5,A4Q3 q\ʏL>OL`ѯv9I!yn":WG6FHkXP%k\|EgCY"pK P hރԖA^ Z.|4]%L|õ.U0$ıhɵ`md|"PkH% qej/BP?rMKe3/~ƺUXi1ײx29ySFJS)SN"E2HreSDڂ*e`T$8||*Xz3de+6"A*p0myB={?>{ yLEGok˔!X h7ZUY[Q.E˲[U쯣 [PGbGXx=q'] qH3W'{x[f!0HYOHq»`)Nd$OW7}}ZŤ1KQ-61hLE"",&1,*s8/~v֞ix(,PQ#EElc2PBcHjlj6#F(lI )($X{CB}M+&oJ*!{=G 1YIIL!2J᥺og2 ]BOȑM!h-LS< H1 +yq#f7u1 CC0aGC7}\!!lFXiL6+@2`[Dz̠b ϩ҆8~rp}6p}F2 ҈\5#^G'ѯuҾ;៽Ab0P '*DQDI9p{毮|nOuA,h$!|G$J(Jc8͆׸ \( [HX(LBZ@ &Q+r@u;  `9+X!ͪ<Ɂh*LYPڑYXJ xA)8&_5+QRԚfڍC0wF? l9RϒUۅ4|%ϐl&c{ڠc&4b 2pȊ _T`niQxRnr7>{>x=`69eq0؂!=g4{ӄna05s!F򿿬K2>]*qM#NJ%0s xPd~*]:Ռu5'TFh `ru1oыpE 7:^VXZn{ثBi>VH;dՃcʺOoHSr)Av­L-D [kkTf/[qk抌!HUkDRR2'( q:qK6/ %;4Ew7R? @)ܠ|/i6>ڏwOZP.+Ep{Į)KZ^˧'5|G}YE Gyc qp &fe| T>|sy^MRK3^OA UP `"jATJ7 Ds0^bԽ_ A nmR\*X.4eHd&_fh7UsHɏ< cyɹUU?+o!+HM7 *=N`&?XrayX!JR Fe.u"4yp%]#VsKO |p\7(ؽJfq#4 b4v>f_]RNθ 1 tes'l WlxurpqRi]J*Zկ1з;+OhBYbU 3P1Rbh.t%`z@@&K?e=ZYn׳ GD aSi,d x&IƷS#{b@@BSS3%ȉե@s ]@uz8;Z"_0ňdb֒ BH<[qf0D.Q/K߈,5g("2 n1bo8Mj}dy5;CTͼŎ0i FIldN6q/_ɬX&QSb j{3$ ,jk8Zt8*ӤN3ֽfZvvQ(IsZKq2Oɝ *=%)~kn:ި ܚtAz9G]}F=]OfQ`Yӛ|,^F* RR(湨b") ?~ˏ 160C6: XB1m4VQHZŌ FƤAh4l"(بŸ{Ǘg/ F v~=Cٌ ?UjWd Pdvc4q\.">j!:%Ja2 ip9Oj'h C8=gڬ `X_XLHH$ mQ&[#,˴Q&$'CF_[ٵr\='w)VHU]uW<ss:̣ޥRH}&P3pL8Q#یI2ijR nSB!ӠmnL @R|D[}Q8NA | q7@`2 @0$$/rDeQaL9HaHzL  dS, EY2^9kz,I92-6m(쳋hX/ T"J'>\I |IdepwO25ƫz p@"ȐpRNJR,PL .2]?NV,j8R$6˟FZv ,%˘͉pAuMl;tuPszv_1ZT\M:W)e.e8[[7} bMͿV97  o,IdrD@X8(T Tsa^K ~l]tT,${#wo  |yI@@\~ZddmFg~69D *B ,DTl[Q{`UcԺd|HJP#)P1@lPݔ#;>:`b=n50XFlrㅭJLؙ$ ˡtw,y҇h/ kS{sn9;?{T5(!%X" 1^)(Q:!f!8d򈨒0dB#'6%yj^Qdˑ*D\Ezhą"Ѝ3B[Ƴ[s &EԤΑS^ǿ0λ'?OW6%F(I۝֯'^zQ8gky>'^eL38e C8PpKzf8\O2@lMoGXm]Hp0|+WuB2$U'Ƣ`t$Q 1%#8]':؅%NW@{-.u0A岼}+nOVEK;|m_t}CG77yá4-M4%x1~טtwK<8DDaK0@Q;3>IH#'A.ΩzLR84" a;vR\X.9c/d.[:L:s%$icnΥv@TA^,s{D݌ƺ0#{|CPsKn`Fe E_;#8I !BWj| !v}MissV6_!DՀqh.=XYEx0OV &9bӕUH3Ԉce P?m_CQZky._Q=MS"ڨQ%ۅL OUQy=&P|0|^5h?,Oe5߭see%/:Ġx}Cu,Cb~ـҝ'li7պ(57ʗRWGdn-Zi[]8KYh'Yt&R )fܤ! |G9Dۅjڸ* ^⠄E}g>,the Ua S%8zt`Köeh믠y/DŽC Z_%u=coqWG˃d%M?OG_QM?Fal" F lI͛B@^Tئ4Uo x ē,]UB͇zd$ڦ (=!<,) GW0B~|zדmN.Oc Jb Z)J1clj#F[u 󵏺xdX ,EQ`Y&QDRhQ&6LX)* SXE$!& J!KJѲ]dBӡ"~s1 ,LEul9Jz˲P+ƭK:$Ɗ,PP1W`ir(fYC{0*C&m}lnx`~I `lZ~uvub-U(ER fϟm Kwlj%n2t1805Ms @-L%ÜuwwۋD2I@mg!yDށQgm&bH@a0 X$H'ܐ2ñ ""dǯ9 *D}mS`2:DQw !%,=K3Lha\>˟Oʦ0Aǥc.+xA\/&5M %A.?[N5^F Vl0" $t.jkMUi v,?q >/8d!̈0rٰYl{j(sb_ꏳ2 +3&@Q惆kubCpeGWJiS=& aEe)S`77^EU >Z<ҺH#m '(@kutWNp2?!O[y%bOy0`Nq Fύ=|woQ8*sx( HyH]À-U{8092: y$'`"xjq z a+GF'။[i?G 17d$>2_&0OR?]k5֑P~cCSjŽKpl#NqBJ`lU: G]ｑ4O9>O('3~8fdm]Ncנ v+! . kD8aLD~x3XQ;b~&  HQ `01Xf˕Ye,iZQP&!8Z\1gO^b5ȊA A 3%H/3( Z(,;߀Rl?ۡHw+Z j8mBDDSDL %!E1ICA1AF/W2`&2JM,LT$LAƊtl3QXPe6 1DLD3aDr݅S@+EԳV |K.(laPh4Δ[L}Ҁ@Qe!'>)/)5,Ǝ=$11$ *ABoV㸨XwT4i,5S"L xh?þ8X@G,($"DFRfhIBL,S%YUZd0209Q)ZjK$6[` D&}D0UCaLD HhUggybA`Ol7,Ǿ7JU˩4 \TY rZ^yu٨:HChOmcw}HlX;B;FY]C 4p,ۨbِWy6lX>@$,mj8Tz+>48Q/iA'^]P}P {"Z {ri]9O2A|]d\Y\pຣq b}qY ϴC SH bIɤQbwi0Gϡ !ɗ$ꗅ!-dd1Ax<'eVDžLpD,œ'k% |]bSߨTUي?H=;NV~^tza9S^S9 F@lPos3 mޑt5p)xT9EMDhkⵡ 5щ 8f=3S 83X{gґbHBػ Y g>h˗C{+nljdK)^yicp~8y\ 6ok[ZxHZD"GP*0yR+#z&dNȜ`RZ:vzJ7{Nߵ8nS.UѾN=D9;'/+/z[0Ndࡢ]Iq* VWj{GKi^X% lbDw>߰9ܕ:Qmg] VAaJ1>~o#^w46źb[5y zˣ$_v~,m+av _)L5 Vs ,Y =#ӤQ>>J{=O]x\'sU~DLi'ɀ ^oQSWfh` L;#ȹm}l@@ C/[sno9G sks.DP*D,U+dCHyL3OeVLu}S̤@H:?DD*{<"kQ@|E,00rK1s~̽w͙簾и C B&:Eѩ;eV^}|o=x^Yf值DͽQ5:4vzea2&%j-$ӪF?ttnѵj˩ӧ!b^;QnF" vZm<⣂}wCf- dHۉ+7ٿu 0 QDTF ?sJ} 1KQQQUYDiIQ"R[]<^qTb&j}_KUu{RN_q6* /"gb7OUO)cWyaO/}.6BeU{J_9_}Mwٹ@5ϭe?aOF__K֘C&z Nn^ $ 󩴱嗸$|72uL(M( Ծ8>oG~|&b.]t􍓣idτܷEpo| 3@*ҦӕڢvR>hM&+U?g J^Qdc |[$~QswaS D_Y[#T>IB$*DA?yqerŒ  htBO'ebWtFj мN^@)SH /;@VL-}=o? {ו^1!* фDMӣSB׿Kg B" GuQ|7x=UJx ˛= ~[͙b5"?GoxH[rl<7n/pX ]ayo)d_[',u BEU4L%BƶWuLY-`ׅ)O1GQv^@(EF-'Eea{I'_B'ضnO}_RX4lV*Jc^%?wX@%\Ub _f~6 >!x-}},\[J)J.A ֭/IHM6eH'SLzZbtw;k^&XKF"\,:ݳVdb^a !0Bvβؔ=׌Ą$ )#^)6wc j{قO6^Vp&\; ( ךcFmqL?Րa֧|Rxe7 &=WtԭlNRv9 7.YaPlM{opƟ}٥.']ng`K̋Pi`@T D4]$m ^'r.GCH2Sx>=Qx5roFq#֏wùbvD.R"ܮʳ|&B? f;U!32L 鲎*),NLȽ+}GWnlva  u/Ҵb*}3eO>Wl?%$vP۽)1QOi!BM&O@ }$CP|7wAAo.( ٳ K 'ߛ@^sy[ =ji$ LM[*OOT1Z5$ JsBk ¢⚂M%mSI@8 -L P(*r:K]tSn֐'[keJ n{3r~RȒ#MZYꑸi.@$ِH[Ń@+]N5v4Wi|z섇֤B$@I MHd` )DBâB} /AUJ^.󔬖z*X Cnaj0\jE9}yJ8:Ry}Wyi!FhF,xx|lC1pPcH$%"o0|㪑ީݱ(p3:#/.2yȾP +gɔ1>>%b'T |jz 13$ﾓӴ.D$$Dl,wZ@?. ŌnM\~/ɿݲW'wp=ۦ7m=O?o KkUa1=.㘷I{zlT,|=Qz6%"*>}Q-O %e/d]vaƲBx&!#} 靧9=^(3#}&, HP KL¤C0LC19?30@jb3Խsbu)bV'{d LS wߙje'$% D6Q./YU@'A3H R |l$!>jTr;)&l7 ~bOxYÛIAs8: Cn M?#fA'٘Se_W?H|^9PO\W~!{e8%1妀B@%/ =r߬؟XV(+ol#kLG=]  uVE zIk'ov7~)3+Fc`ȃdsIJzkr @#L)CW }yǕ;ǥoZQTx 5TkUǝr}^882T7K֪U\PEvW㶮wz*Znj1=ð^=_e1~L^X{7=` ~Gl Q97_I<*5iH`ch^b~*ib .(e8i=Yi=( g:A> |\Rf+[I{ Q \(:M~|"oS=,-!y Ҙn_lΆ{Tےd &# cw<Ņs:?gSo{r/y=λM֐`_z;l1ѐʴ;RN.ѫELLc`(9jű48؍r pvYF2u?g].2*\NF9Pz ,_D^H\o[\F<-^)V 2<85? H E|nء%L`ߏEW9-5h~o+^e0u05>Y?_Ǚ'_pm5% PYH@%5U/TPx^ c(~O6/[iǂWp]2jpERƫXMy" B !冃/Lб?,?&d96c*3cd)+Rĝ(!%\e{8YR `dЌ3:l GDHĚImES1 0a \vmt8.#9n@|NgHR`&8B%ɑC/8TjrŔ-qU9R?N:hj,q68(ԨgϚ4Z{&ΐ (AjP/?y!0)}QWy(]X&UQ %x\?MOUjpp TWB۳d՚R8I <"Uv؂GFzT[I "s$^F.Y#6񜑉bFp`>l^ &sMmwIA.K0ַ ڝh,+7l+X]$i|;yGԒ>]&!972q~g٦EyגC뜙:AR:e9~R>mՌiumgzT@YB(HT חv3;C@6twM7kyš4A2DQ4Rj!BP6L'.@'L(L2*W_>ܹ\dvl$lk]CjYv^U|za\<7#"YgΘxޕkhk式`vtdvx, D >ߜ.mAXA`E'hLkz]܂)`!Wuy#km CgsA1K[ZRF`p+׏i(*e!Z;.%@cH^<瓪e&4`K*ki@h]uy=kU9⩎Lb܄VVn[d7%'>{)3!%"!>Kh0R-gpmcT Kwwy{hq͝P`tE3' DGip01[i 1Fbj?i&\.,*(i~#n06;=/ uE$Ud6OQkqYK Ͻ]IOr`|TQScΌ\[tz:g(JD89HpStHvyW"4SLKa O %-d&ʢ~zCR"mJ_7pݪjQr)r|G6(nS j\4xhOڙø~[4c1´K$Q]n!?~5/LfT|lcOkCOos}/ 7oG3^8Z:C@ì<7:_I9>CA$S;i>)uAYoWUYndҺhK~%)҉8EiQvbReZYcCoG\H)G)w۬JBwY_S˜y3 [EX87WbG!A\[) {gn'PBrrCtr'G3nwC/%צvn8/`\<Ȣ5>ɞn)F=X*Mu#e$" 4Q%tƫI@}lwrݝFk/v24,[%ZdxgS,a3A2G^ü&dЙ.1DE[D8,e>3- Joe` YwFqӼ.#~%>oXe7XFA dV6&w"ؔ!)U) cc<|Ia,;RU?S*QYEטSSbjvߏ^2]}) _;R.Dq_ʛa٨Nn N)tʳLkMaq93<7kMV<0%f3NQFɦE46wB qզA+C([/*3;;׊ VOθ ^Ph7AJ3G(|$q`C.JRÕ Ìb+#!ȯdj͡>>n`g.|¹d39 gsKN $ݿZ% "rf}єv07*Q36_C6םnoݰ1c8gda>qWx۞l) S&dLGD(ӎwx}?mvM@4+ 'J* aB|seE`{zQSxgp}k4}y iR2 F_0ť$)HMa0/:7av\8:8z_f)S6c|T!A!D0^uoh׶J0yyy ʙi9Rd(, $L 3LZ-C!eRc?NQ vݰ}>e$I%y9@y #KPC7$\~KkOaAz{fH%+h\v-l7dţ#r:Fĩ.%F╢JɁm0&nA{#v o=1d9uG4X6qQkoⷈLb%p6.|+^ ͚V'97'aoV O)_\[~q\!Oy?>zM5Hn+RG=81u$W@0lmP` Sk]oc,Ae8JRB?g!z=6( oD!$q͂Ry) *mk3v!z`ՠbg? 9T_e7"Pf3풰^ "x4A& $Hd)ŘPfIXl!C;(͒4"Qp}F.?ݺVϧRO̜)+e[׫?~͙+U24I?>)sttF:?G/U+"ˆs<(:|$aɵrTډ2.QPA3@p)RP~I/J]%NJ`2.VZY[jŢ dvˀV!K1ҷZ͇?ch!BD2er_ZQi~jޚhwͦR߷V}1@vO+ˢ~_a|i6+Ws`WbG^̚f7S}x((F2FDb!iZ _fc4ZE%"cM@vb{E|ѺV̯`\+cxj\?$(]b/R8]<3厎~EQ_hx2Šo:;-]E}&1`gKr*A`hh#H2 ::-4,6CDb1<#64.ź^v W5p* eDޛx:>1"s,yq:8Q:y5[픮Z ?$LC-3BPOZ:*('X,a02/21w"`% ;NzE0A5@ML=0h4(0֒2~Λ@Vcgߵi4J}cc/2'˹?Ri& .6P.cK97ΉeEBj2"eZ `G5Dqsv4K:ċU.;fFmN RP j55 ) 61"5H1Otj"NE9cQ͡l68 6E-:ϙ8Wՠ3J8U fj%DjIVJ0H\lZcr"#TmZDX&jBF 9!9@zJH: 0~=m?:mHιz(jA%,wm] oܐ#nP~ m4UoC#C6l6I Z(] 2GѺ\*AHwF3Jd8Jgm4LjF!34Y"^r,@5{cB|ah鈋+`2D嘃I]̧.d7NF PjЂ2+}Gegel(_-?(OC8+pRR1F,R〗Q\CQyU32`T]1}!n(;KDryT2NmцVLضQ`GA|ӂ{@.j >AV.Ik}ط#O7- .hXƁ'=-z2T _{ަ?6Uzèd;;"wJN:s}—36*Ϊ8n1V߹CK|Lm;8`$)6ʿnNC1!5Fפu%0U1N$d`YgZn8ؿùZ#nn;gs -.W=> ƱY*e2ʶUogz{AC t!z73φD+G@8Hty"58{> nrg1Qdz_ȑ ıDoz-Pr^A +04YSz˪ӋO:t!qf9(fs_}#z>bZrӾ}=zl$UKs']`W3߫fFy p:< o%]vSNk_\r|C}>{ ⛚? v˜T;!k>Ɉ4Yt@}UH J K\^eӆy(%*ݏ䵏.#ǎ?>i"Qޑ{'Tlj8DI$ \oXm_ p/Z>ؘ }Ηr ܑvZ3E9m7Lr{M>5&Cjń3ِ:|MqT ,9k3s,~>;7O]ݟ/ꧦttT E yls#tTjt8 Hkg{VpjV(#! qoi?GQB BwUNt^}|}n+:ڛ61&SwȾooWo?:*IFAPdc 旭doqz$O0Rp J\C{:N24QM_(_Ψ]V,lAm=/ P:rlf )01ZE4Q%- fiAnEGӯOo .a$M =ݝ46Q"oM7l49\dE"VHNU*oa*"lz#aD {-{.spzO} ͞kP{y=1~`_alJAp*s5wDcjNt UO!JDglS3H L9ysO59{]sb̀-I:ߵyRՀQR/0|Ewr $̤33^ɅA j9ΙB(`b$y*Wj`@i 4`}CtBndLEk(Sig{{+!Ң޴P b¡KcICuNz*y5w>~Dl*<>. dZJ ΋+2}sd1m~NՓGI3\yn7X_^d//Wy2 W1VJ)(` mO BH&8>z ^`QTPymZ kWTo6V4>0 Pc'}}<' `~Nա,N"V ,Þ3]VA ~UNDT M,gu5wWv$ ZL6 &H!I; IA%p4 $$VoU= RD0|cҍG|+D[P}DAYD9|3E2Ia׮03P $C831ug2T LߠWv +`z\ڏa>~i 0`>dBaY_3`^GwN-ճm8#p~(Mَ#=\ˣ?aA;%ca$ M hxFH}*Ġǭor?t쪁#;a(.uMxs,]H9pGBuxnl?+q:6ޔDVUU#.F8ES?SA}gED 1>m RS>8qP7BJP<1!( 3aK5rǬw隋vJvv=5L 1j]ۀ۱D4 7OmNdy%i6 \EtK1ih i̟?0΢ǢNp\iL[q9a=u˫zR}R#9bҫ"W[}>iV"ش%s=봼iƩ Ͻ1DK#u< n w@wo:( 5^"@BgAB{ʒ`q 7$<7+h=S2(q 6[Sۉe3h)u-j684S[`tk:-d'Y~l>F=iuivQK';9k0 $U2Fm=t|*wuKWB4t0P)Ǵp_3 'pVRljjc,sXڅzH8xRvX?I>nGB_G{'UnImq-|Q:3=-ua@g아N拾N_/iGtf(ވ/WBv5=)GjJLao.{uhMN+ݲ-K1Wq>&se^.[^Y%8/=F(7}&)vx6aUɣuIȒ;,nAOgR>j 3^=SVNNն6D*Ū1\?pa`۞'O-(Xv6?5? yG1}-E_#T a)?MCl»1[X#n)87'kaVDj2)/UH!yeW:GH GX@.~A}9501yC^[ GӾ o`a(GFjE%yL`vM50w=VubSdYa% 3Co d@Nny;D!q(TQc^7ZfiQO~k_ns]wx][q_XDg}Z|2e)4|̎\D""G;0F7 R)@֊%Y ) n3Ȋ:?clRM r>~mZƩ=ny|N6cgwt? 1}S:?:JKUR)p"1cJ ; -_ÛiGokz#t-p a~Te:^3'ydArÈ'AOpޙobF|^ U%N ظ{GhLaTKNZJ+3Sƭ D˛:恒׶e^JUS$Caj|s/[~}^9CH N %E 43#^(&cptw.]!"0oOfb -JM?55S(p86߅"\G xOFھAgmv0C)vAHlC d= " h4f#4{emC5YV^~p`j>ammGagϼdY.ޚXADj]CJSI qMJ,IIG~Ň-g{*0K%/ QMvەKf6@e2<&2Jcxh}`b!}(خ]i9W9upiLsZsPu~6#Ԥ- 57&8>(zb qgt>)P?Ў}uf#"8_.9EgzѨQ! xA D1 Dhl=vg}3OV̭ow;mC9`ޞߴP袀WM5)+~ GU ҥcdZ{#9_u/S}d6z`6=C Pr-rmByg\I 7b "ϰLq3%_e iK/߬{~¶H}>n.]O¦J c I $4Lw|&8.$ {6!0=G{})=I?~] O=z?ȠT?HOawWu͸YN;zd'`sV=?GGĶ*E l1:*X@J  / ٢AYkFSܷnc⋭mf&{$6rC7TKי}F.4Z^' DQ~|B0_Shj՘ ZA^_xYk_vL)Zer {ZKjgڏwё P;Q3hm yʫ09xdX%dm+Q$H«VJ3ܼ[[)KP lKq{-}׸@5>x0\m{ KBC?CBI2HOB0L̐O[}8"CDquPTX0z-*BaRRI~_9U?~hG{~& RRX[Bhow7B\ Q*ٮ$K @g$Y-\MMΰM}SY0 L'w1d-ԵKQ>{?W6D%va%(F6U@^w3T<>6Zro,2‚%,B0AF8V"}{5&+ף|wMf@NB檅5=9Tn&յ/Ėi_rU8D.uXY޺{e=Y=ɤ۾^w [LH ZgJ?E- vՋ,ŵn $2f 2jB@]I2d7"lH~9Qdz  R?;$>TSu[daN{ eF4&j"`/=R>Y#L0mw'uZZRx\pHD*èX\3U!*"Zq5I 3!m|@q,p֒5i$I cZ > 5 r&brw1;k.qҎd_#DdT$JCkIɡ tbë# $5 s/kz)8_'OO`?dݲXTL:Sb `vb\0=hC޳1@hjx##jnTXC Ņ64z>" D +Q4lUYnφGTtC$^]2fDf񱧻ђ@a' ٴFQdɬƜb2j<59ڷP2ڸ.ٷx(a|os%/fվL{mR\n/-@*!uX9B9<f|={rhو kNؔ2OvϹIFMR >oaGnjdwMӍ/p+HaQad K'15gb ٤Ĩ3nlyB  z V{>}h_XZ$m"ġ )\"yn>G!<#z\[S2~-4$ǻn07)W{+[ L=qwY ,!9PP $k p YXq1ە{h0(g=GuFz=D <y^L-keؠ5_ oapkZA;R^o77+#ώW|ϣ~l5{xvrqAPnvmLC v-Hq mzvo+\R)QN g@r =1M޺&ڦ1x;Zy~~|РaZ>6}~,یw۷y+6}#6yx:5fu2%Tuz-2fSŐBwy+nc^Az\" q` {<˪bi`oKkFM_<2rlT_к=[]YHLp9uqS,t\3۽&#(4B3Tkx>@pY8z>9}3^u8оߢ@lZgdZmN'+ۙNknjYCֱyv9G xE$0 H∜o0>Mn JnA"a[L{؊}ˋ޶n&K0Ԉx{[G׸v7p%|"ŶT gm=PoVtndGy'ݮQ6yS(;=ZhUg7te8mZjwu翗yhHO XM}>A/UDHV8[Qdd@D>r"k5x(Y$1B@3ܯ/*9f$q?܊q3.5~f87}׫d/y?r% ӝ qSiw)3 .„$Hzq,/ ) ǵPQ{'plZ+isP9d>Or.쯞:84Ȕq n*=*unk|đ[kN=U+/Z<$y|a`n7T Ҏ<$qaVeEwqQƖG(1ँd8-4 L)9SBʏ09D`8Lg<.n\buoKݤG8ɈH%@Jl. [Im0d7yG;RQ׃NS6:iXE܊ekjӐ(\6. b[Ѣ{>^V 4Jkn4ލ9wwodsU祈zٖ_UI]󋴹+N;_.l\#_cvGq uѡW(T]RRW**pi#tH PY 4 ]j/pz8^CUg22r;ظuHvz/N_4$?߻@8êɈa 0 C7Lv+-`( wڡf>Br @/w6}Mb_*GԢ xK 'nk2Cm@ J_b{7=xd5) ]G<ϳC D@!_@+' `!VE\:c[n> 5{UϫO`QX.?^6Ы D_FbBg8뾝3gKK2k6S$yV^prVTZ>Du)%jYE m+}6OAk'w౗?!TWbbֲg?ZӗC[\ysWp 710Re Np\!3 }$$+ JANs/r vp?cJ߽0,[cR0dIP@ +?weh|lCIQȽIAѥ5[?Rv}yΪ3#4}ÙzG7C,V:xj${?:{3ǘA<@~21ZnOU*W}>dj.G=P57dbq$>=]libp$?'AYk3l) ]7juI6 Dr m/ɪxӟb?4J.IXƛWS$-qBǑ1;'C_p|I2Y( PKTࠉ؜T*;Ts56,LPb~Jn<ߎ {eлfqXy0^}/^us 3z27/K]谏\?j'p/w+wrܼn0+lXm_U(PPFzP?d,_}|Ϝ_TJo֡nhi>+8|-ȭ,eg{V$A qKLv e!!O8CxE,06)'68s_|+tP%7MKhTIL)!$(l.B~AKg7}VhfI5']0o(~qc_& ȶ-&7KU=z<9YH>^6 6CJ7l1i: {*AxOL@VouȻ_HSk?qMDr㶱{ɉ 8kL92aj%NFt*ͥNHڭi 03%\U)-W15G3Nlp多l+V_ē9^iVZ z"Vg@g]Kǵv J0QZi}h3L4é7Ȕ9 E:-_UT]0WoG{Woz@Z~EEA,1tq\,:[AgNm4Y: I:dm^up;ɛ8Vv 6 yQ$!O Ȕ H)BXJ!Bܒ, 3\S >{}87w*yv}rp ?^2vo C[ղ O?X$b]?ٟ+c"횵k-)H>'}:Uޞ?itX^ :f9V/lp{)],1PF.u~tS^`%\#,J\΢L \\*–=;i n_CmN9h.6 84otƕb;*sY:MHuFŠlNX2w3Xس֛1pL|I/Ύ)p,v}MOWXQxT76H &ҠhWU?"+z'` P2e<0$@,zx ^FC!Vb&ְ]`~_[@]@1[%Nƌ3Y|7KG*?j+w>/ѥbA*CM' S ?}t ={=I Џ O ߡ,az9l/͛gý}{TR}& .fauY< tjW+ܧ7s"k3fRk0c({{VFvp+^Ms­5p䫞cT /ڇ+{JpaGG]we6Zh*"C>`֐TMwfR}_-6!^HC!/IYQɼs)p@~s/[Q;T/:8txl4r#QqKH͹E-ؒ o,Y=3 x^pąȲt@8݇ [̤7Ɓ(WgYT|OAӃTY,՛%^A ]5j?ޟ9zyQ.1$@8";iuL? ϩ;u5 n mlkBL{YȻ:Ll[rԴN&)*}|ŝ Z'IܴAzwk^L0Gi@:?F8Ѹ`Fs&+S0 J2ZQ!(6i0>?ߟ8迱Ųc{>o| @ ,@! ICsk%T hTEb=o$lhڍhشhѪTEUڍTX#F56Fb+calXZ=ޮrͩSO852c٫"@ H2F+O/©=c96䵪OL~٘^yFQ@b5xDp0^2gP`d[@BGf").P5Y#\@  A A Ȑe#$ rC-w}]wt\ڥ9)TL D DZsqE`0I% JCݘɉO*_n“*c=:bHO)VjT"QMK7+O zJ"}_fM(q] H?0}^_kGs&HqTKd3c[/G*c(/y3KB.{z5cɒov  V@QL!p Z5ʐ{l={ uO:y}bnUy~;u :eڍeѷbNϿS&WeN<%ج yŸ DƳAee1 87[^ # mD6IOaM; 1KApxHAG^VEf<x*:h^'02x 4 `dgU ^o`-g֫.uz8l %2`o0ld$Q.!"[hpuyuM7C*ƻ39/ q.EI6 x6Q%en77g>tzI1;7P0~O=7b,NiZyO}1@طsQڣX12^p^wMp1+A+pcⰈ:D}@{+YWK6݉u]Ћo' =c^(aXL(;~#qZBI'0-M{,ՙD XԨZhFld+͊E #>2y՗Qh#e\]† 8 @$#NE/=B!DRyP0 4~HtVx $LעhsU66C'YmzgP-VŊ{5y5^SQ6JV`B3 8"y {͈l?+J#K܄ffT?|18W̹NUq?3NMhCF:}HJJwVhZab].KnB[j fmW؈=!iin$zp NLNbf[*YfR ۼGdוu.( tw*yd_PVۃKH3)ZgEwY_KaID@` YUDwTn n <?1t#Ύn7|9`o^4Kt|ݭ!v\v)_gN1#Dԅl~iaxF{PE rB[$S'I|AoIb!0ݺ]-?~ Hn6d b|6e65ӼP9JҳPk!: z/:D & ;iQvbeTU;ϋ RfX:y!`ƙ KM(<[DpJ"0٦'z4 uUQUyM\YRs-poO(y`ri,3X`RE73 E_B.jz{K3y^cCL%zg 0suwϝoyw|l:/{iIH ZES)`1cF+nӚ GCkO^w¾αZkSb_aZd0e!~fBpbƭ!> uO Du=uc2OO_S{t@ pߑ.]=icMt]?Znqkw6t̾B7G*vRIsq얙:lLߗ- %v#*wYkE[Mi7>";ɍm j4ͻKBVQ5~]ֿU2\29enO= alcW9B@a4;h87/ݒ=7z71♑LqqKrH[ 0ƢFNEjUcA,2&3<Œi:*`r =Hg鹰*a0,2oX:?J*+͖4]*?Dg_s1d{x m)i#Bd@QSx :i[ Xl+"|A- B2|Ig?HX&(?DK.mH iMqU  # 1]n?'&;PC*fDJCoI+"4!YXsPOQR.P] 﫲cj&.2ecD:gec&J#!"c'GrZ}qd.5^^\c @2BgŤcxS4$_'@Hk<<Ábv؁#/߿}&n1<wN5UȘ~\}0+,z7gXuo1#d' ,ih/5\ݪ߮dqq3VwHՁ26?bW$z _Κ) ll@q{g4(IE%.\6B`j̼eEdяK m [6[S 䬫הgkw̧wDžO''KL2 u0_Z&׀ "ꗲQ!Y,4"b0.c4E:fh~F*m~VEYm ʈCtNאgcowYھ%g9EmI~| b PFОqN žءh6锭i6OٻȴLT(j!ք Ms,-Ӡ]TKL_jNr[n~LԾs{Z7=zf6GY-XX! +gc=^m&^hA7Yq{$K" h |"li@࿡NI92ڽk"ઽ0a\ZQ)[Oe1P<9aelNi4GDwqu5L4Ův,UswKE{J;Wrn9ͥu濜 7!<~Mj- 伴BeuY J r~= q1_fS,o$a;.i)=kaފtw[9[D~7pCQ 0D}u oi+K4Mſpedy 4j#%rUbOJ V<kP\%=V:겓 ;/dH/my+fZr(X#D|MS9!)V.ip өcTY pҚv))H,T^ɞ7/"QreU`0QzNOol"ٺՌL8 )_kABj%( + gD><4}~]ӝ$WefE+7ЕQ5{똙fN>-ˡ'o2L_˿x(H,}R!~{ =\^ѡ:;6R~Vk'Kbf~OQTnfwbι:+h:Iֽp_^X[i~ c QXobeLxً|YݲU6\:1yPczK_+{Zl>*^'aY8G1D)9RxX%:i&461$L,[f5L͢o?nΈ (m/~]V3G&VFcZIS~^2 YqĒ6LNnؙ/}4v4Xڡs֯[a>YAJy1;Rkp&ԟZ>s$ =VI+zY:y=/ґm-|s(?WĵpX@%,B|²JAP˺|/4&˜G<ĐF քc 1+H]SMq2}YpS[zp<Ś8:^J@FR`ME`(Щb*5(lk<qe1;=Tp<)7ԥ5gXc  aO-RM֤˗KB./u?@rno7.78s~tQAX_澮?L^3UI}$8^RwPu`c$9J(d@̢P}O_4u>9:_2tcvsubp'ԯ@_72"ZK3)թ8P:8~2#\` w3ɭqT *x[h&Q*4l5~ƒ;(U*?Q [;iԄ)/I9bi 2 >Ӷ;>?wIzָjmy`yt2.d4: ^.1VQ>E'c 8-#!}+Pa E(h` yXƪ yqFX 'VEȑFʗPn:\7GD=.rCk})CM4*LD4ɀRxu6k9G$Q\"+(1˕{518O<@\a0S.|= CWYN"MKY>sc#́+ɩ^%ݛ[3iLu1J8$IҢp9ýWHYa\7#H"{nxkl\:E~:UscGBSM @H 7(ri1qꖑU< :B8= mfh+\5'bޖ@CIeCV86d5 *kWYi5;Ff/E4hu&Yf>e,!( M֤_}wu [?q%wKP/@NZeל{QUx￿q` ?%VFW;qPBo-G%-!.O~VS=HlvFE/Ŷyo_QNNo*}<]9q4mANy\0>d?k6? >0  "DzsdD@=%8(ŗ[si+-9\ʝ٩M睌qtJ5.[fˍֲex6.F묃֠@x yLwݨw]/oLB9T irƳC# ܀ uϴf۰`&^M/6e݄ .@XptСэy%M#!r^g)I6Ey$F1D4@gVR0JrϗAS5D?_n 4Vƪewm a#B= ZfwOY!L'ߍtҸ6)HIɜ{%=o+4Q y8"JaLǭ_-_w5JﮨgɜoyǿR5c]7a#v3.aS][9KmQڐu{RtHnvYj.*qrHnYkۃbՙdSޫI(MBE[z'L eM7cŝ1:8gQ:IĀ1 *D *g ) 3_]7[8AiASl%jA9󰣉& kR&6 a5̶Qd,ߚd#'f JS$mq,Gt*e7bS7Sh/?f3˗N/BS-)[tRE4[E8p^`ZA~yIFA9 _p6PN_5R˾I8\.Mf @lr-r7F-yyc`w&(>ɜİgEV@F1?7 U F rhr7C2}:/z>bcm>ώC¼J> & Maݸ=eypQB\OX+QDN/!JNGuB1dzNS?gk_3K,ѼfYI#ӯz_P]{l ? sVN7w6i(aՊbKh)^.+^mߵA hKYO}''iG"z. 4$2e}nX ` !I`H0X %o1D?$O_#ASlBW龜Xv~Mw5*(Ez-@F$&ر6=mٱ&HG3?Qą.sCgw^a``/B-׭Qf=U *SȔ j* # X1'R$eNX K" &Cf$"~pI6AABABJ A(3G+ڈ8x1eK"?!Ұ>+|/?Lgw"KA|r>j||_ާwodoD}` xɮ#+@͡*,dz_\8orʟ/<>a;C1q 2X/`ݐgՈ ,0Hx^o!KR> ]^e+q$#}nTǗ4D"9 nwcu.B?ہf:6 %fA퉇onsӣg<ۏM+gAߗ}%x8чͬ_y91"V!ɓ@Rhw\ދ^%D :h=SwP>FlhYGiO0[O7xܚ19x$ck$=+8Nƪ%ˎ P /(sS YQO3tVM0A9kaօe;|\nrra_g)o#qepq dHp*ـd;-P7He{\ 1)r[-5'??lo%|j0bkKDdE$ڱV`3Ӿrz$X< 39R,)ɒ뫦/cPT &cBeC'&ϸ{ 3,nI5T *'=khNepgէpI?% n~Ƥ`^`e= e5+`J'q&ܾ}05g߼\$Ku{;6l-[Hgkph ؖ #I\DF |e=3|%#>\s;y(. SS 9C60JXN?/g$-Lz tؓZ >\ҿzyXTx10|ɉX^~/-t=-+UwCY4n#ıvuuX=ȈIm4piۗa#*&>VQ삿ڝaV~ߍlz7UTX |XW&@~~c0W,90FMZ ǬAd B|2|Rhu(OP)]ʙԚO>5"ϊzY'qD={Ouի]V}!DD Hf&oDAd2A]|ˋ>q. ~NK~H(JGW 6lܳu"&< 1QaYh|Cߛ+fiо ݟ7ʗ3AkHCY=/3kN쪚~skb6 X¿Qz|A86Y^L DVƬ/;&|z_Fi=3`12BG@0$vq+wIV./ݧQ*v\Ne usB1CïCl0m 2W8q2c9g?/=X #S-Hu1h!f;<& a C;6yzǛR̐,3?'@IG٠;HL\'6PL^$z/k#ְ'6Y:J 1/ +$ *+`??0kT~ǃ ,,2_w=(^<#C:#rbVjxWɡ>Clz$ "0e~;+-uzj/DŌC% g&%@ .hlP8 !>^3cJ1r{Ɠ<?&4(uH3({@t`Mbq2IXlȈF=!: !^-\]obh'NوŦ|rD rr@g҄aG'm }Cϳz0 #/Y "@Bn4~%b$47 !a:1[ y ~ny2u)Glfu6gܫ*""3i46 JHEo!`˴ZNBnwTq|l\`q {9D\^05 Fj³lJ@8lO~1O8`Md@l;C3q~y^c9;nbcch$D"gI.TS!INqصeIvY R8A%KfrkϹ־[P؈E 4DeB ֺS5\uuWmjںeޖE:bۚjیҺSSLs޺7]7ߕD"l<'Bh heђEF<᠝{; y)b \'\2KWO Ќ$lL*1Bc!c=К, NpI\߿ϔf pStoRJ+<}ab J= h% [=~(p %jN"5-K8& éfxer5Գ|gUu@<G ?pJwL3VDX|NWmfCBTar.9}*s[z>]}/L7ɩ魰q@,rm&{Jb=qG1| o$YH )UJ˙56QhmD h F7t|&(8< 4qWbN=(jq 6ݕ T`a2q9MR㉚oж;.8<1&֝C"7v]F. W:}a:pμi[cfcG2 $ssG{H5vdHJ?FTڼluˆ]qU7.B;O'.J~6fnEK|~قY]/FTmޣLe1ld@ =jQ,QD=3$A|cF~5h篤iOm3[[{_߬;z ŶuKo?߽8S9"o I2c CHp0 !%zy͙5̎m,>k fANd,AjG5kAm_4"`l/s\s cgd /RUE'lYMTfD>Ӝ$:$̳$q׿P?VO/?"6R,` N6^m]w/6:Ѻ}{΋JͶ$tdU8qv,[ [=sGv K oN~O s4Etb?{t_,1`sa睄X|'W~Xӡ`ҧ\D`* E ЗÙu.Yr>k'Gʉqx=>ڔ g?QU"Q+LZ\/ҳag@Ϣ(ŐƋ0Ԙ3fjf0b&D)+&6e I2ͨ6HJ#d E3 2̕()H2 Tɲc~BEK"9oA]#eOA|\qI@7)dX{ݿ;_'kmGNfH/7ym&q`'878zc1m>Zj'0_b)ꞁ H\B uБ!-bt&Hjժ(=ya-{(d @(@& 0%(Y̟*gml~,MSG!@d2%߃ޏw+_{uW};s_M|]̓`ݱD@sb<{,7oTBc"M>Fa=d_>L )H{=B@HE#AO1ئ S]n [ sj`J_+┈^x>r@> Z4A$CC4_ZWIFգ*Vc&݂t$A-\CZt]?&Ԟz簄Gp~RκHJ[髙땮t}Ɖ4jnjNZi"#E+ȦfeGj"-5ifWKVT׃hXH#@ 40$ x \f'UCgAjG'(?x#ydu?F1^Zu~M, 9qVɧmJ;q;[t-Gpb$=j^+r\ssO?Wկ6%b"vc)߾lsrU1狶Ȃ'v 7[vLF#srzŏroco8w\]ժ}'n6 (Yɉ,qzG3KT?Fך2ٌIxBGo=k/-& zٯʮf; 9s@R$@3M=(ߦig"NS(Ua/;?xJ|&sL_mf-gʼ͂M VrQ gSqəX { J$۪Q`#监8++|F5@CgFA=e Vg}^nsk)AS.D)%8 RBvgyI Н d ;I!_f~) h{f8׺T(a7>u o井/aL)Xgв$ίʯx ZѺ Ð0ȸladV}?}ץ^g i flJ5Y-U_ӻ|)P`tk֩karH4 FINY:bW]j/eaG:LaAF]֪sJz.FSN)(& lI7~)TJmg?XxUf~!{Y<5{[lLq>g6;}8hq{.nwW?mбP X $G|\- aD\!6>Ŷ0b  RǟW>Hft':AM3#$fᦵ=sbB d[gCኆtSl8bMvb:lɿld&h[eӨoDY~^a;=~˹/~/q_ڏZ%͡ਁDA51)DC DW`g6IkVc. ؍1A#3EB2kCS@B$URrF$A0i }?5zd=Ne=uRmNo*xp=M[4*+^d`9&C\:c(^ioפE*XBqL.y)~D30 s `3UHYE;mK j)Hsp7]O4A@  u v͇Dur2uyW/ީ+KWL6KZgL7\]DBxh<m(*W 5l%N&Pqz_$r'?V=TIǁaܑ|VpL%4It2ԆXāC ilRі@uZ-e/ 2|&AOwQ6qY4ʛXG(&,รNI5I6ugN)89"3g q+M3*Dh?HGYI$Ԟiѯb %Fiw9 Ȑ.xFY+ u=`l]<9 =1kߕQR9'GFC0Q'fND|}na¼[.=cY=4 _WSG['pj$n\gS? U۽.9 -yIau~yNNqͱ[5y2o|| uz|~^=34u| nZ;a (  ^K*p\\Vom8MVpVIes0@6 $ t-*]ž5B`4ɨPӵ%sP+q~s]؆vS;\+<`ߟ\r_0@I(г!lj%qcz'LVfU(P杚 ۀ #^ss7Yo?3ZLFcfF&S8OXJt$'91{y8 XD>7ߊ.ZWQP jJs~6㯋CmYcQ j# l#$2~Q<; |s ˣE~rŗѹؿi^P= tMZJg+˄0M3:ۮn?)HCiXU/&'2чeǭJQG M/x~Nn+// NC( :W0('wTG]-9ZQ+;ϔPLNx܌B[u?*ìv7rL \d ]ՠ D@?-kdsX&kXTTa9ʬJ7!ۓ3'b"+YutM>c8. Gy{&of>[ZS'S;QbR r>wFJe?I փeFH1D+{-To95j(FTر {c -9?> 0ӎEI>/; Sj^43ܫTΩuskWvY7 }+~7jd-vyh1橱֓P׏+35N`Y%WʳFgݺN-Ƅ)<&nse4I-3ddr2A?f9MBq?Y:IIN"`C!h^$9y{4q祂cJЁQZk>a~JaDqfmEo'RoA)t4E ))ưxi'-] u@}a*aN_<:r*Ucpj'dSoU4ZPq=3K􋎤"Q9 *A@㢨֝^ YsĈ ^Y{n>1t3@RS8"a-vȣȳeT1Xg2\JbZU_tjSyt<-'udkzMH)U<hېp\5ib?\?)0D&7f_Bay&m@1 ]Is7t=gYtv%+cujuHoUBˮ>Qc馀<+_s-?ӶRI ؄gD5sA NBQnB="~py59%Q^c~Pkp3]i4]+?P ЁޠL>M.|/桻>#P [VJ #q@N%N Uy`(Yyhmm#ϱ<\r< % %m$ai5A 3 YvRii-G+j@e9am5tU.jϷοt|}v}K+m"Bu?Z5XZr`5*q?{r q]Y(dA|H>e}#LٳJIcX]DeNWJ[yTnȈa<dIvǬ,ާ.͖o@J8\k,jT4?YQIЀG@կ;#coyȭݷ뇦nPbwbzvMjF^d{s+^Bx/-ٽowx(G1$d (n tؙ|{#}j3d}*BZuS54rRc9Vl35DvV=0xbOIqzz~[fX\>&T]z d`?mi٦2S~]ճl?b d-H?*SL;sTv(2]fC׆"Y&Rbtm60y2.=#Kc1.IF( 3TL5g؄en]ޕ?漱r}c#b.A`٣ q;n ,tvѫӷ_yyL^]uf>=?ؕ2a!piYj'#vOK.1MɢSzgӦ eת3llQ9^ XKsλo\rr[FOzs7=ffXGyvF_+ۖ6 @灈ڶo{}ۻ='@.Dl|ʇ\g%p^94"nYAR47;Zͯ)u*R5e{)#;3:^O?x .aU<-#Osp[E6R3F#_hr-p*qSc&ycz8nq7vd>/ߩP´O<`[*N{(8ڸd3a"e$bnu9 >ݑο7ɋ`˜)$ݖ^]GDd7"75|nEWLtkBZ'uHJ0FT_Vdz[#:$?C6Htq-SBs(i1(/Xkq^*1>sVw3h8xh blRK_)HM1Ujk`o'=oaA(C;'uD4wنU}WG! lPT{^VoPʋДYfǤk..5,V+^yx?~p:54nu'ec@M$KP:85)<750kEy7H& d1 $,7{ilA#bNt&w$W.cWCy0Wu<'T#@mJv6yrcUz%_/f5Ϙze[5ڷX)`[Z n VASHv^cu PLG^eoDotH7w{-R ɭџrg!VF RPlJ>ޭ jT_;o&ieue5u_(TU'iKilcv PXL!~2 <sZaJ;SZGQ< wi_˽r2; .T˫ t~F9#1:l[{ns;]2 t W!AlF3֕ 0)#8+-[˿!E0֟-P2 Ռ.pt3b4wH뤱3V u2W%frCZďiDcP)Dy1궎A=?,u3\tHԿ>{e.,)iُF챐ƈt=U߉,c>y+r6G;ff. :{CZ]ZUm^Օ5>C\k Lj~#-c7Y@J<*hl7"y_¤{g!y9ȉeo KK+k!90AOݷSaIOW*W[N_X#7pרMc387|w:\n%4|>L^y k}.rn!\aS#V64tUT( ,cL$2lt)7Up1s\߸Uc}HЈE fI ldx2;7_pUz/3K>>k;Kh:?NU]ar+3\+ }w;=Q4x.aOlz&R]e^<[)5DW#IE1ȓ$b,e6mKK;>k\N2GY%KBAa\wY~2MSM"i7I엽m2` gv/%fWƹoth4y'x @ K( Dt:`'sWVb, ZlήmCit׶_yVe2e$@&&|Y%z2CZǶ\01['W1Et/\N5lTOσIRVS'Dτw6`~wE}&gf\=S2oyz0_  B cIжQ}'0 e~;Ǥ%|}rSvzsUSzN/{^2 aT\.~:Z[<]#/g!zkY L $kmC,e͐'SQ0be]a2̷/:P%?@,X,cdReo͑4˾l Wj|υD`46s=97ʧ䣬 'KQγcݮw\Cac$ricn#Śuju;rgvlس>8v!65\;~YY<@$>j3VZFLG澯~>]DyX |eLS&Du诖D `y3ס7H$_,}1G/%3QRD  'vD֧>ob >/jx~b I@56mu#1i#UsqeDM guksOIBg{Spԡ7W AL&2ʼIgp:--^#S &#DROg;F' dEp D̺/ymJ&*Cgŵq~=gl5mam_`seތ Od>- P;7Yp$+;6U `.^jqҵ YǶ>cVF}6\5;An|y_WLrF\?SmM&P)hIhGm6PPL@RMsoxOzIMߜ=nnC9(u葱w(^u.Do\@{$4t7nqǺ G}˝ ps^?\(U~Q{0-/r`HJ*p; htY5 }lm(l끼Y2$)te}[*Ř̽mv'p C5ܾ&#t)LeIBOϔ@*07 ng$ F#ounP6(WufFplZCgj("A&kcjs큸\y!4kgAiXL_ pVYxkjub j[bUWq/I8"ȳa _߱ckOFƎJH2XCyբ;S6Mcf铁`1)8܈֖ڎx(]%Z\S;Ic<*4xԊdCKYoS=)ʣd>\8֜'"۠"%#SF `&Lt."2{olG:N8#g +])g͓iR"UM@X9!Di+ypmݯ^ gQ/7ϏxZw+yD/hHZ<0ϒP8;z,'].;}밸 $f v iZ%)q}¿l-}s [dl'd#rQfAέBr".%-(f<fe: Ul5:#h7 ,y;ͯ6Di3LR/)k8ff&,פ2o!DE,4j) *kTHa1\pWצT `tK9p|T%8#Hv(X7|>[N;D9aKk pOj&kʷ%$ft}Cy囑rebƒ1*!qupu3R9hYX*̋V+4 Im(v ouC LvkUZAՖ4I[.L\>FrTؚ)caTj$YX2 3ء{ܰ_ԺYI V6??_,c6):)"eoxlkg[vYlZiG+]5oԔj)A%?v%MWnV =Y'U e2<]!ܺ-zfb[$2\b-.ܤ \]4a I$mo}[9yϝ6.8$-@17W]~˟;'뉼.$"!r|叜AQj+u.y_04UĠ>md$sK;,XC/6?w.c3T_I^8<ƛt5Fʈj+S~{8JF61&ɿ\1k4jQ Vf#j~b?^V|>F(r7`Ns]}jvu0u(|Zk@$_Uf%7'_;Lt9aG =7_dt!A`l k3B}XAkFHd߉l x<9.: =+VVɌ0.1 +bb`\ S@+ RD0@ /a]m>-eCx{U`,oZ UV̶8YdxhhW*a52 wv~? |: AƢ:bح2TCYM+dR/~@9!q;q8 €^kGƼx iw d~+ȯrDdKLKI{{3wzӓ&϶zqz3r~{h/coi\p~w ھᙦm'xoJ1r(kۅEb/] ^4s~c'MZu=y /`]`,cŽ*&)\Fv濐vW{ķf5L]7ZM>R+0íBy }Ն1'wC]8S]Do{ iYݎ5_vuP6Znvј||o-~{6{U XE#pHyxZ}O?f`}O !wtJɲX}e|^#½`L?5ЕxizM[Fi.@q%fn1e{ /B [/ap\Hkڷ!ؘ01/@iР@lԡXzDs/v 2 @jHX##0̥ޢk0tnwiڮt۪ݜ@@O ުz@4 k\W9+Z5@:5][5PZ8VPø$:*GZWsuQۭ݁www:ͲŚj{۹1plhPI't9ݛU޷UѤ&s(h5fO}}րS}#@[Mu e  @ءŘ5s(* ݃Glz ^((( k6i $R$H*laf@S*b46l@16dƁ$o)@j^Co} ϝpt6kzxPi!ޫA] 'C=y.GOK>@f/>}Az=}h=wwGקzGg nN^ݙ$;8ޞ&a :)';d;S)=7{lc\wsD;Vor ^aNT]Oz뇧)VGyِ{G3Me$;;g;`xή0`83sco4 fw{˦zwK^oY;{ǹx47n]٬h.267|}7A.q;wӱkD)EGMt*` Λgorٻ9W$j({Ws׽{-m@dju-u۫ȡmVmuU9ϾWo|%)T.ٜ&Gocd㛭h%k-7.3S\iؾ#U^d"[ȕygm=;;^^w}sv}wZq[G}gՍ6oC#GT(zyQVTqBF& 4 A&hFF40hhЙ4M4h4)i&LdFAP52@ɦ@ &L&=M@`#T)bPi LM4di 0ɐ 4L`3! jz&S&2hɄH =RDAx@i 62L =4F4z4 hjH@h00h4&L&hiC@hh1 1412P O_Df#~LM8VԐH`CLg#:t~SƑљ1 6-k8Ccݑu;W>~)xѠ5SFk OS2U8N2`b ˕eXsW-i؎iHҢ*_CC?3zF'Kq#ll05mct)of w .Q ɮr,5<فZzE#=O[s+q,y@A׌&RʙCa6P*q7xYPյҨ!}-ז%K;@YuĒiCsWh3tY:;xNDz.w,|<2>^E^mڏǒiޚ 6QnԼ]ި flZ'FL&/>-Jj RmW@h~8A]N[ 7^*ãk'$1ho6:0iZQܪ@zL^C3i`%dt0L~G^+3PayRbn)5+4AJlAzyy\ذZJ42ͧ%uBwF'8lOΓ4 c6C>>ky-]I,ʦ"Rg[yaJOqO mLM' .+#ϟ:d5 ʡ˅\lrG !xv }$AnjQ|̞ILB猠ň"P_32dߪ&/ U3n@Diq_2bT I xג6&:MItzљ2GUSͤm# b!$m/갓&[>yxPtG2N۬^R[ws̑&,&zKɏ+x7 h=vIїM8=sE YwnyhWd|\kוb.U{ {ВtX.i9ɠEZ欌Ckf&q}U}mO7P0ܣEAUV`a ݕH?8* nNs]*Kq,ٯ7?N8}2HɑtiGjw}v߯@vOo:x@4hPr`4'"Q -j8 [5P~+Mi5}ED'oI43[ζtXzÚewö򋄁)$ R|>$DF.>+,߰ySPBɢ6Y}aِ{{[#H| B>ATY(JC4sD"ז89-Qď LXa~=)GD1 v eR"nn,iNT=E&\ +y)>?g)mL--@L!*IhYMĢѪ-~bùVTzˑ]H3`dBJ87lK˔|;B jy=8RaE6&Gau\:V(#{[YqmwO `7C7_,1mKV-28bdn\كVحPuLm4o;M,e`Vjnr*˘. Ȯ%WS\tL@8fA"nXʢpQus3 7u<2B.CSSkstid;0ĕ$(`[3$FDYl34$}kgY wZK E5!DHģtq莑(BY..4ޘa͛F|ԠʎbR:\;$x/Q;$ Aa!^{;AtY(612x4{/o?\_ܟ_Fq)_vTAe y^kb\qV4sX _rwE zJd1,%xqf>!/?/MLE|3 K"krԧ4 9nJ #-gT[hƐ8Xftk %urp(x}"NWcy6$-|:ljm5$+ M+𖁦&.G/Rmne9 :]!َ }'ۗ Bpi&xH' "'aQ>?$'8۱ ?R6Vks"e2{}5z"TAt_Yޡ3B}X /Үn;\ 3$%Vd&hmպMIͫxg5Oj-mFir ߮G^u!UK(s JFF< ήR Y-Ukލvg}syK*+9YgŜ?kX9R lm"vԝ.mmJYI س7| oY ˂;K}/vE?7F48vf1R or`n'+NTg$n uWnʖYs,ET8zfWhsHTSg>6R?C8 ^d③@ En*"c4egOb^n$Z:ƑBě]YmtWiJ9Gґuo(W݁n3gGCky;PyiJ !9 %ȐH|\qIʭqVB:Q`qFq%ÍC]NsEsٱhh) 2BS f 88z:9*D5 &e;N{&wuOMsXuN!Hʏ?HAʑs):,'Qon펅OIgb64W&t&mNLVbX[{Wyk !LMPءÇ.RD]DQD`H(kqmǞmMa2XZ W>򸩜nϑ $`YuKiڐ}rj(C&}U iqV~m6lٛ bA iHFa8Wk)B 7d;&q@'$"9vem6rZI 5Ot-6mUɬȈYvzdi{ʨh%=fYͥN) [jFs .K {Yو$b~NNp BwI6԰U\2Om r]%[lc;77-7& 04y tѻB/Q4]Q"4%"ޟVmݞHg>lilNt8X\nE6+Q5'8@s^ݬ12 ӏ> [rb ܍Xh◓:Jh$I[cB%JT>, 4_v=,tJ7umC#gHl;d!e;!i8RޑkICըNg;9Ɩ{ݽOmË3g 2h<:N0HPw dU,Wh!`PKˆǜ xs_HȷHBG)YHy%ߒ<*LZlJ{ `'@; iD rX2#h1~Ը摺߻ |E+m] `؀}1%u2{nĞ9/n>ǨBAWW|nȩ}R9"9(8N^_!5s<4p|ǨD!:R$>#Ir&_{kqHHJ;;yw XfzWS"ȷjlXk #~y^j}sS,5li2%10!jrcExdK~5x0h}Q̵ a 8v jxГ0:] yJӗV,c!wS.r . DgR\dDBB%(qHr Cѩ&!F MKњN"2$$d6M8`]ޚ+*PiY[y6b_ ש麽L hł VҶ%JcbJWaΔ QGtLRppi]A yi4Ro>~=]^.Q{ʄDQi|uc#TI[I cYwPad)ПS-N|+s!Lw=SK@f@ߜ"!wXv$ Lդpgd{Dea߃_Wme7ȘknN?poJ!V`K CKT.8x~s_n^bf9_^ LԾ*NM\eMMϩ>ߘ0ר}Qd ,{.\03dab/c{C9d6+a,su}޹1T2dAhAFF,%1 Wy湦ƦAEp38>jdN@cK9Md@p6{`8)קEkSì:,^ Z,r];"DcȁڹL\:_3y#%AwEKEur7x(u&*F :jQO[۱EJO]Tl9cQ#?uB$-,Y#LdG6: X\zR:;lÞ _R9c 4=-PF<VC;a#b: # a# 4- ĄrBmEQA[[8!-eW|_bx>!1 jt/0 rmMO0[زz^5ð GPHy ];32zʸCD5"$fd%W̡qG t^H2fГ27΄@S%%`pJ#Ѩ mY:TrAHG<)* -3u2 "%h;KI9ز 270޼K̪`Q!r,4K@J*c""TS'!ޒ(72`yP"H:KdW:P%M5,T {BnuM0u'8eͨ.z/> ʘ$ST:fm!"ɞ.b*oaӮG&1識>"j!vlL_g;Hn B ׻2;}ޔ'H g@ x#q` Rz_'U-Fw(\M( Z[W3(/9m$Nrܱb ] $#Ar״S1AɇSAhk^vtJ7 l8KVRD@?y" BEpJ1b"LPG128r WD"5syy7[ INۢk0z6ݎhkRg BصbeFx@{1 <#ik_&ћgi)Mߝ,!v;*B, qRL3VAܦ26+6x:y3D.(؛Jb7B-Q?pXI'>R8p!~eņDaZ>2E aڿ_ޭw;:7 zًNƙ'S[+>nnBr0S6X̍_#\z+2r :[_3cg-Od.=IuX1ԖR!"75"!8= pI 6o o@dV?tL/9^G}N*2@Ix0&'3_jhgZX.->7t@6Au(j)\Z9̔W̻'Px80 F @aU?:X M6B .eS =›k]'Q!<J`(xNKEe{+Eu08n WD.!Za Gf*.K>VkzhY'^y'dX,M+GzD<Fmu6ȨG\C rUP#wa{=Luh _dߠQQFL^#p;-Ż[>tpo&v<XI Dz>32U+J`Q e"5=q>LV LK2WeP+L%ڷ!f򚯍1df%3_߅{i s\5?nWtacaũ:xA{wjU=UAj9);(S-:W1ࠄzދ;j|o=+ DDDCz; j\;1(u&@nݺ;xF{\fN'NGwjs<[r| Hqa]=!  Q/cSGK>])i*p5vyrf6DQ98_?јr;:<ӷC=g?h <W%"5 x,nַ -+Euv8kH@s |O]iSA,lOq>Ge {7܉ lk]j;= yo 5Isc ;Y5(`+=.4ԉtGt =t}=6{ ы g5s"l8nQϽo<:"MjQ{'jkPj;n24>1bWXT8R/ l1ޕ8_>|(b0׿wF;SY'm>Gܝ])Crܻ s")֞t !HRv6Qb04o)ҙe^ ,3\9.K}G?O=ѩ?ӕ?[N/PjwጐD \1jl E'p[Zvg_{>=cVXs V`I sN=$1?&BB( (f xL<9TD!;lX 8FpPZXx[D%L0B:꒯O#|fғ9?9${>|/>Gˆ bp.}fv0:D  Ōs=^L@$赙 W* X@]6!il~X) <.N/AyZ=A7ܐj(MM4D[u*N\u#wJ#VLo%&SVCjL\gcstwh`DBUpzLムyZZVo{G`B9e,3Kϰ oK\`eN:Gn*74FSIp A $#vo[|oE214P!#E)~-#_$O<} B"(hp4;OW2[Cј,Iok,;O QRws?_ˠMykv%jDyP~x`P:  Õ%f| $pQ'HL!Ah_O഑SwS@޾kcSMN'+ aC!Ҙ$&o|L.wM]f6 rn9L@D70{F0_j"17=AJ{֌1[C[<[X1a^#ȼM[t-{ O'=[sTC+BR.,"]KNe=|̽/Cj+vF'0X,}\L!{*bߚ!6m*{q=t"[l~ѺxF6 fc|g^3Ч493DΏ0Nn`|^ :/ n<;f @6f`Q#zn EA~N/ l6sM[YW^K+! i3JTllsxqiNB"@g^Е> 0 b 5q| ţ9-n+-S-˪FdsY\Vrm! ).#vaID<rO4yde[ zCvQ 6>Vڗ-:M& Fspި+mX-#?;Wrv?WV@  9W8b\j18,`traΚm/prid8)tE: Ņ# !٧ԲzSbMC[.~4VU^% ?]p:!6AGѯO_BE+hO ߰jp""s') j*@JSV~|1DYhSgfgb;Qy:~ I}EjEN rWj+}w˃i 7׻ Q0|%dxF|?eUW7G_F?m`>pr0>mƫɀt~(kjf 6/W ׌D^=X Cs6F qJ'ܿm$#Vz<-k2,we2nĕ- u<80I |*(P#48Y\4.a` LհK|I;V<Isy<|Oj<'FjEI0Db3Mē>9ge"> S?؆(Z^aXYY?* g7/9,]F5mhϣ@hKm)먦7|%i:i;4t1' &'T(Uė/f^NٿD:'\PEvP7i,!ejXg0htV-j,;'te=mMR%vys M~uHkv{k}i3VP|mh_#z-Qz sha )O ic΍}(!Mc,b[ƅ)Dfcwm}|PwJRx3Ȥ21,`q^ʘk*k6k'J'3 im tK mszUm}-q|<_&Cj% P:JNi| a,~;4\Bޮ*/P]z_bc=?grM(eX~\OڹYrX:_iZ'jރ)@2Xbυ8!MBd=Vf|Bf_5-pCZn.Q~)~)XڈC]?Haܞ `o}^O-$,jH9Q{JbT$rɟ=_anVCuw>:q˰/Jw t*OX8EnKkGR b"F!DD(IS6~s(Dq0d͵k|am $!*s39l(צ\UbM vϦ?VM`V2޳hM;sI6ACKyoCI3T>{P]r:qw|ee* Es/b6[c Swܓ.FRݲѻ "7P:z']//6I4-FY@Q%uΒhfN \+  uΥ>ZMp\I^OSy79Ĝ-  a Jn֖AA %ɉySOY>zSbT?ӟb?:D{j>>JXK;jZgW$R|rOGF0Bt@ͥzD,ja1 TfwsC]i'w/9a( {^ ' .6*9ap%џ~`ܭv<<~)0FGhS.#P[7 \Lz:Ꙗ]Mfc}mɠ8 <II^LAoS&V{U=0xWhWk?J5)y񼢘jU+t &G"1S64r#ZY,V?bxbiKy+66-_R!ɇZF-zu*H8+.%^L/νA`[;@8ƍEcTdNoX7 C/Hְ0OIS(*Ίeȯ!u|>eKld^*ɽh" /z]+'2[f4BT ? rbLu;4[z{96dBK! T!SB K?߹a$b$bӅ9{z U_ʌʯcxy OJAo>T_A}m}Z.3Kn s(`HW|l1 gCaQG]uz[KYǝP6 |e.R(`d*m]UD\ӆ\[s;|;,]uiE ,KrІh3:)W!ӃHDcB̠цLb42AT*.nVF]ڴۦX lbݶU5ܩc@i\Y7oJwlBYu._~'?FTx V?o󵏂¯^YnEGV˶oט1ο!B,A~3|V/Ø z#=0͠g*P@ !+@U×Au ~u) Tғ'v[t6P4zZgI"Hk.ZYVt)bϔ3яm~tlncX&Ŗ/09l"gsE2"ܸD4V4F]56!J/=/`ԵRxoFG\Js>~W} (O}Նgb@)|>~[,E&7Λ87|:p&|qr 7/~;.)`jȖNTLkcLa= Vgyҭcvl?^2 pnȘ.fvnuvt9Wu j)M?7!TkH,Hw-vbC.RB;(KMo1 %RKs򣧕6/Kt/ƌمkSKzW+./*)O W! o&mｅ5J!XXR1bqLu? ~WBV!'w[hlP EF+hn@3&]X{ ŽjWD *{ ԔcGO<&J%v DӸ+ͭ]zps8e!!KaG0|V"VA &v5$ BeO24XdwȌ[<~rszjy7Y-wJdĞq&sJ'NT @xLc70?;.+50p,F>>O@|NTY\=D۵Ι(2rQ4uYB^&\L̞uN Jv1wpʈK\-\\|\$ `&[fkRORϟ l /8 O.ƻؾkBV㞟K7$8aLF!+:U r4 b1oQ ֺiۇNOHկ&NN7=dyfޱgqs^}x|`tr6ڄTX!iNbC.u-yUa2HH0"E@piзy)gE(kRPvÚ^>(T[ ԽnYtH[x 191qn:H[m?qgE1jd3iIxmn8آ# jb6U ]Xa@9WrV7Bpá>3 ؕ!QK饝K(T,}|< Mk8[llNFzۭۮ"39tV RL=*CܟyszG7l-oM+T؄>>֮tY.t'UoAS摋9Sww [S$Qa|I'0$$Hn ǘ;/;!ncީr q3z ~2 J7F͐FN.k[^ {NI`RL0^D5 Q'=ti<( f3BF%NNFWAMxo8Rr ?N/LVu!6dT#uu i’@I,Ѕy/ˢCTcsvv<]J(;DJK18loK|J1H70D+N Ros&q.=Ս&zzeNR4M {{]wvg{e"E=dYJLU>l`b1\:JwI~aw{Q9TmR~nc31Ͷ.U.lRUg2&  ݬkͭ gr2p=*?<#,AM|i_(uAʤ .ţ1tͺvNjTp! 2~ #,!+ 1\rh,hD-hq8RLZLWƓ lt#&W=j>l5NacH/x:8ܣ_j:->-r9O7) g+r: -澯I9ʞ:@[~3R E֦(#n,eQ7ڪ 2>]ļ rp*[JvwvPQ mȡ5-6F^U[aXlO +4+j҆^QnT⯾3­n%2z ^yL# IqJ^1MЛ(ճɆfHm}/!ZdU!F$ 6kdizqPnRC"įfL0lG>V0AЌ5*E(x.[ L& ,.bȈAQS+ Dn&r Hm D^_l,*r^[(i L<`--j6]ØM^.nA"RР:LR"H~o_qS@xcy˗`6K6~NBjrbͼ.zd'j3Z\jx7O^{ l2ڠTvv] /+Wvvb01h>H K,J< _;CLxͭfZA+ ~Bـ >v6S/9% ӵjQqN'Gq:̄3۷le3sF7GRm[ke[>[༓9XQ(Bd 3Cu7+bzv;Dd35lV|+ w2X(wtp 4J3*hr~XyOT^EFJ?Mw~rXE.<@s0/t7U̙t Ɵ+yC?oa8˝Q>~H) "BY$@(9+axrx {ZȒpGw$"ĥ+yPW1v{ZSb0`% Lf@CZ(t1fiw6Urtl]x K@S}RfkH[1p9/x?,^CGݞnLC˚7u^2m32_4Or" wFO3}|e3kԣ k|! O YֺM.2Bͷ(8z㦩H߃w~r h+7L;r*)nt"k@kġR#t]9HƝ7[կ60OHk/Du k,MnstE΂Ԟ* F" lb~4]i:ƾ=4<3wV (K /o5C+n7_%I5'~{W40ґe(/-yXŔut6˽QjK ct pr$B=Xu^P"ݴ9kĈ=zlImJ޴сfYlIԬZz7K,%ҧ<' nEtϫתVg*#- Lt>B3gs_ӳIj{׸:!"ESȯŤhjz]-?/{]͏?1!/k4Bk'׺D]߾r+ypCiM1u&>&1j3DTcy0k QUqbGjߺ>Ϭq^QVKgx׵I.stK`8+ga?Ã}eeb*9^ioCyq_+`,@p}1k#K"(a $\U9 uC@{.42NyV;K[ET+/}ǟY#P:ORIt;:NnܧP;7ſPN1~9캜3dumVN  DDoMĆ$E{%/6o'(m/qs1\fP<9RgvyT'DxN,|F%y\'(xcmܸIl%*;mms؆^ڧ KTŐf+Ge Yzjx,`@&GxKzv.8xX )˿ Ch"b*  ׽BjL:Y 0s#>c&bG֡fIh؜CV&q+9 =u̘ 0GHυc6g.R}e3]-r^z!hխ]s0CǥxB??Siv_wrK/QsR+[<~V}!  <<01Bx[^]zN]1cGGzpfT*]֏[c_@y-,Tot)jubx'~]4j#ƲجuX21{M&"(IItne\b哧1#p:P!/HNi짐!wu9_ۄm xN"{%7NmDO#-$.sao4꫋&B3=<;h5׸i)DNF[Q!6.kr0l/ ћyX]bUǢB{t_8#E=]~Sf@Mq3;LK>ix3Rr_] wIU)IW)4MU΋f$r23Cp8k6<,$/"#PjH?ʸ @v2-poe`^Go+TƩ5keO9VWptT|.PON@zzXrn[2Ёax|Y7+#iAJa2 I(Ξ)K7$HRBRRX3`@\НH҈ԒF?҆+^veEIp$4@h@Dzw'pza"Cj1hv]񶜩sU"@KZѺI@ld^n.ʅq{ھO7 nC6ԔT%kG* tG|=֯Q6Mhou5";yE(ْwHҕփ C*Ո@9'B/#CIrㆣє.gc ^E-tY`-aH*%(ݢr~>ba]FNiqg98I!:du!s: tH*Ω hK?iӿZCh[ wNsU*|7ƅыj t& :*NamAn8Ԇv%0J9p!PsO!w<@ r0 LhA$%.L3-)%:6PHPe uz[k 6Lz{.7C2BPM#2Q 4ɌUߝs\.lwdؙ5S. :HS2RQE%? V6r)F/ʛ1>0~?mWg#tʪjne9CS'_ 'K^nrLX.ah!8њiv _N_;G͑*UC,t|9SUI,@"1VIToBeB>3j[ }\  }\m{eۺ;Z-Ymfn5 &w*g[|Sf@4ȉf3lv+KzM/PY`zYs$.+V$xIxXun3]-frZ88_:Al/Hë ma%+3^N:N]wgԘND^dC׌y% a|*}+HjkSwBgĘuW`1C:YMA]>6_̆G,C^~C: 9[W7%} efc؍&ӛDe8yB$zu->̡j3KY&ՓTArbtbNa-L@tm\-_bpvE֧# 2\-;}%^\5HZ3'syЇ|@%z6rmԍhb3f˼%) {dͅKS0ugI;5{'RPS0%BHBIq^$"3fIw]W&(cLb( 3a3uy9Jvʄ`J9bL'vnύmV@@e7,h~NlNmAI~v o?ͭySfDk ZHgh1LH "AFVez @Ӆ:|$s1G<" @ bj6ݿ;ም֯1۱胉Q8PX$CJL`4KW`)]Poq]0i!`lOzzjU⑵v*m#aJ1!RD$?8oW∏li!phwKl񴣩05ƒȖ]G?uGۯH9crI$8}>8|py=p7sW۠஦;#KN%2|s%=7;tX^i*uRk70*#vlN<{íGC֨wkv]ӻNxP_(vn# +"0av[Nl?@h&='Jjfo^ (%A86lÈ)oY~<-(bBcw9;VVt;=o?#hs3&I!mK,!@bEmK3_jaQ2u ѭ?SI^E³:_Sp˧ Y1܄%ܺ}']\xg1&ũ]v}vkȵj y 1e毉=k ӡ2&[9 ۤq {l;:sa5dQ -1}f{ي,CYڍ'3ҢX@! IWnSɓxaNjF7 '/At 81nUc><>gk VF@{m&LRAa7d[W- $F̑^uLe_5_M P }\:C WH\#f?BF@CqĦR֣4ԃ|I4( @ 8Wvߝi]\C+Fy&Nzbz6=?`dhS6{w;i'N7'Pŗ [,nvyqtN`rhw78 yۑqCN6eP`h|vYcNJ ;4 `A޶6=gex<<\_ARH/vL zqVXb"EZfk{*<< ۤ;a-l׺`67I4NEY;$@/- R(,n$p|kNn`pxi,J\EYvz3SEOTMu\_Ƀ\gLuG͞:^Ƣx7.<[Q6}Ƞ>*w27q3au`ֹ+cUm6%Cs۾ R>fOϛcP۴|ܲ!(~7RG5twzȑ3ɲꖯ.-~,$+comVZξn#> zgSJj7f X׈%׍LiXY#0O_/j[aܸXr@hy3#mhn)phzc$ȇvkIؐU9{ I%Ĭ {SS'y? u`zwܒEN; 6b@}eͲƱ3U'Jg)H''+WM|Ynl*mk,}~ˁ̻tF#ҮАYN,,8C&ٴzL{YifNf[us~$LoܶA@ܥۜVŇm3!n DA9n HQ ~P A[n=&8ƌ쯯cpqlWsD Ė䟅{EÉ 9cnF;UkUkUr7- i;̌=ߵ-HzmSb"ɈpT L.ڢ4BW7+U]ϿJzK/nbnqUGvI")xo ya A֜bs"/y^?4C -}xMFUdy;-;xXq!sx 4>n/ct +K|4EW8PsҦoq@ҖGKet^43Gޓ2 u|ּ+Kl"ѱ?k͟C5jjT|hݜ^#/ّ(ƈ[0.] *;&Uł;C֊%h駹'2KӨaN4Y9 QTh Pm TG g`uXk44Bf>RH#"a^kF4'WP|21b/Tb|&]K!Y Kw W´,B,ѻ<('98ww 8tM.I) cAV?UCBof/¸pYggg љOCU Hx%f"xvoÛ2dxfݻSB7I~`\# ksYOvNWGCajۺԼO{W1L!g8!f̻,;#'sH`Ya!deifZ@ 9Q5z~q E4my|sǡk"j'K z]G՚r{ތݯYoN I|q&$${ u('+8)@8G0댮6\:r$T PlK"^/7AJԼB*XD 03N2>*sE\=aU|BAhg!NAPq2#$%"AĄ l?{vf'SaQ|^=N1K|lCZ@ kXB:#u hcM05;g,8쵫Ir_rdfwV]\9DM*J=|ڰ.Ts]rJ3kn  rt/Aew0|x}Y]fM0Dܗ $4q{VIlS)mtctOf3 iZ+OCT{O\F> xيp} v]HKadX"AU7_-ܐkb{ElY$r~?w:?r{}`"R@]xA=c{GYaQbسV j8jƝ6?ۣ)V87s¯`CwBu % l'2ã+sG ; `'&FD?! HLk9`F쿧Noo/i(a/k}HpewWb .L8JZ͘Unc5m E-q1٦)| Rq#mrV2NJQǑĤx#X.l4sn|!#9- s`Hl’k>[薰5(XċRTty:|SfyףAkީ3ua)ˎ"ֳ: ס4U5z,+Z13ӝ}Klk)YjͿ 1%$_7) Hq̚%o {Lb;_Ld9I;c-Le"ɩDLL ع/Qf@A4}4~Yh"d#*H]^vu( lTf7o:8왙 `U >f 2,j_w tWz'|Q6KRn1ћyRI޲G&ⴉ}!Fkgw3leptF`ߢB"7\+:Yٍf?$Cg+Ls(fl9 x|kXy{sCoxFJ3Ys۷Xs|dl#jװdV] hX&/0EH4ǩ$O#s~ wjAL][$`@n-PUHoJoLU@5i"}1 ɺ>3'TMՠN#<4is_GSlEUs)-ՖdcJPqp82; Ȅme+ؼk=*pPI]| ((k γ:S|mm]٢ʐ߸:<ij+ԗwc҈!\ɯP"8}. ,5ȣO`,d)%qPb~H<q-q/Z0ܑ_=Y(nilZ9 h_''CPA.RǸ|K>9 bItB&1R{ WhfT[r" Z<CW5 ֧fT8ξ:M L6!Tt*ƖlO8ZUYgO|%sE^ɞf(5AVy51{ Lr", DT0qD60^Z޼n>A1[3\MZ2Ñ~_(WuD˵m9 ?L_RJk6($j-sC''܊ھ ?Izs$*TZzE>T_EEůd@'fĖlR;6m+O&c:)4{z C\Дށ`L6Nm,"B埒HO|fY=_E_7vvpnl.$L l:[DAqFz1WQwc$PH&gx-; rO-v}ECoDdPY ^Xi45B,'AT)]\Ȕs@<@タр׺+cDA 8Թ0e z;[C17!ʊ,`[ '_SM xxnu,f I=wB12i'!͚ wPfH}6{~E 'M'EoJ>(UhK稝2tlx(k|Ìb+D .tsIy)BH6#?jv 7mX1Y3g 6]/)uV,u^ l{A|tub^ 6 *[%ckЇ6/ijDY6Pqʫ=GXdf#jeJ{ש/nخRb 3lYhk];&k1hV0;4K/o>{; (qZUR!D_ʛ0WOBrʐHCPӈDiMx̱ $hJ!/*Pa9 EQSu46ML`W۔~bkk373K=Peazd0] i8别;Y#21 P9%YQec )c i Ic18J0uPQ%ND2Bj*i|.$C h-%Dž>X=7N@T bcNl@"tS b[>X)#p8_zAJu u1,&2Oqi0q NLLNNɠXK~BqDHD_CjQF>5G>O%5a8وHEǎ7+_.#-q&]ۉ fsǢ)E*#c8AR`Z4(xY9E-`M"nSqdRb"-K)*i<ݙ|,K~8}O;#")H@"p~ޗv\!qQ +A}}#U/NxO"t?&/k4 1t%d0f S.6۹XiG 07l&I?Z ,K`"[Or3{zCttUDV.5_w#oB`#@5P)` &bgOpS+9,w26E.W#|ȄQk M]l#Mܚ?ue L7n%z̀Gδ/Fj gA8mA]9PS/FH_{_τo|xVo?N, w4^BOsv>FP 4 M@?C 17 E\6W2w1qT 2hW d8 aj%,MZFY[c gBFVa6gQkF&}֞sRW@@%Xr=dVN?^P8IO=BoWs k GNC,o#_[@8 yfS,ކ*}dfb|[)1l\6P$d+]{ƞ$U3nzi!iI<ǫ*s6Fm>wXl𡢼{\R!dv(s 2kd7w)DosC-u'X;ڶbqUz &\Y[J j $!9M<.t2d7TQa(uEnyILOLJ5` D@¢LGp}%T'nxNndA QrѲAO_ Ȯ[?Xnm3zHi-P@q!B-k̴6rsoL ~`IA4mi}eVj꺭p#4b,Sg*/]BQsj 71,vً`eiD{G'+F[*ͣr`i{>; "޵<24ovkalњ} tc4Z?QN`pixn٦`$>8im:{8 `v_ێ]@6j 2@6ip}laAIr0I ==9$$g,@A V#RJ@It A^ mXmh쾳moviT·xzù\hYNV+vxVui@׈vنWʓ]ۭkv]0޲ՑrR*oLz*g8Mv#^c4ޅ߆͢]ܱUGIk FsnV(Acu`FjJ': aǣ[Ձ/?<xE#h*׭W8Salm(BgShC VqqC`PLk-z3qs}3 lI&P6_Ҹ5T1 *˅eu^=0PG&osהHGW~[]zjnam1!|ėXy lB2,.@Xu<@uPLP ТЂDfA/~?oC+?2qYo@iCKѽOie'8|%㯖},2*H8ŵH6]cq^@̃v sG OpFl`Y8V-{uxK 1v-!8G1AsD✐L>K\E@wF7GX?Sd3#$ΤI֋m]sAc Q3;!9 _s:\~ ,]O#"]%(Q6'^:46U]*%_7 tVFwfbL$zK$鴡ܬHRhR)8 jՐd60x{XP5P02z7YjfC9 7m>IX&.J# @!\%s4۪glBӏ1zŢEȥnZP1.C^R jËҐ; sK\`n"|C`t96uK iBU:SlfJK+)55Af\'e"ޥxd.|B1\ 2kAɁ#zy6l_e92}c/S:kV5kq r8Ad3h=%7*T- J]Zh{ԏ+'~ \b-g 9K@^| I'!(iQgJfN0p9𝆁au`g 5G/$HfQ5S1`|C[s0`JHbaG3`*Ġ'/Gwn?5yM4p%2#-:0R̐d,R6BUvjgtl|'v) B8*J7 :^tުαH/T)/7=b9*fCVݖ~;Z|8!a? U٥5T:ڧ{SD.3}{C2zU|3O0 U@IP=@8T9G%-zki;D.Ӳ3aCa 5D7fSͲ I.L;") }qM fے'&'I=~ͪE 11XcF] ϔ+ogЌ& 3N]v}H\6m+;LtGΦ}NyvUnF]qp٬ژXi[oߧaE=ϟ6JXvG.-.ICadC9<۾gK8Y< $!f 2ȶU+'wTȌF2Mm{kgd~emq$.!]5~ )q8jDnQ5`5]p.|q Z?h1Brp6=c D@IDۍ;A\rlj ˫gW #x]ۜą:ة[M.qm`[z l&{c (V2\&EnPg*kS>ENFfmϜڃ[! ~#n['$fG84FpV1^~i?ѻYi{!WErmĎ &ri^\9lLa͓{Tqe˞ab#3,yCS $NѿJz)Rc3*m{Id6?[ـswذ *siyh6Y[ 8oNxvy"qZm:9MY<#NFXu yZE=Fp$pK2]@O.a(vn(=?_}^|yS+=>JJ-`-jKnc;6\% :*HIG"qM SHb\\O['faUFɘy pc© [IoPLn½pufa᷇/pK%ff$2Sh$I=f\ 9H>hI`!ZS2vU^PvS{lgi a', d,k*Ovaͽ?AwrzHs;6@ndCAD?9gH̿'cVs*|-ẍ׭I[#QiM{LsK;x|"Mު!E=_Í4{+!N'3/u:&Rf:@̈́N]||/I`lH^KP",h4)m`=! ^VOrl)kksiBTڒFS;#/&s(d3DcIO{ҵuW  mv!rqIYY_%metZڶ bXXQ g.HB2BNnDhH^>igw 4^.ߎ>f8ktGba|ŵ//J6aGt`7"2%seeN_gŔ[]|8V@Grq6 UWn&۳*TVVktؐ,mА",>Ϡ~7m;?Y:-s͋'CG' tϋb?7*y8y[*d1#0i(-`?)o:Pqz-VKblή]00q-$-#&i $MfYȼ,G:AE$dY848l[mOC]lN6ɧɦ:TRBYL;zNӥMz)\ѶKuvm/_`xYr)WT.笌tCb~G#u}E?BZ)Xޥpi$[^؛[\c001uiF1Mٗ9-À1@ͬ&ḳ{C%s^33`,pUO,5N ;KNcu=o8_nԒ,'l gIR`[Kv[lc+wTΥitKcn:,k@`4I!o{eA2EWu'X&JO5*'a@SV/K{$ tKq{D;v_"E 1$Za{$HZj>Lm_ , yS$[i }%ajPͻj&p8$ زQ=:\4ƁB`fsCϣO:ϢOpI;a&!dHY%$?!Y?ӚOB $6@dd2qR!BI<&$d?C !̄$,@$ /`HH|I/B_U&'i\ؽ9-ھrꁨ0`qCIK!\RYR?"LBqH$s$߉ d`HI@B}?]_<A`D(I n$9,);{dܦ-zC!>$jIH B!@|&6@ sL)6Rna2% Y!CoE$IܲI? HaUDTI[0 ]2jlD'nQάVP]gjPpw?sˆ2 :Y_4属{V\PO-xJ wwo㜝݊)TVjt^Y,UQ,1qf1-|w#`Hwg{>x~nybf%XF$\4ehf@Ć$1SV-If@t(/@ ,7mDzj! !HIN$ Iw\krnOe:FPd !6NZB'LZׁD &MCv$7VsyYs$!BIjs#Rz]xQhH FBM Jdg/ͺ7zfd ԁ$]7ooICeDauc8?lt֟q[C3 Mlq:FRqMz8$\ qSgzzU;BԿ8#_ڜ!HyT׺Ƈ.Wdiub#"L|ԧ3)8ȢԇQQld ,xΘ+ir(!R PJj-+ &ڟ$H ]U'=L.;}uZU !=R H|K$$, Tۺ,kpjlVl- d)V/jžF)rhY2ǝbP]cALI!voͺt[{I9möxZZM[,# K߲*ryE/h(wZHY5&#HK,DQ|_yEg>1 $Y>UoYgErB 5ޞ'8&a I#6K4a(f&M|qݘ2ڡ &,?AΤ/Nm:Q% sM[uRD2LHqG6@iP)Gswa4)tH5 I9-ųeu羥k=ƒlW3H~@IcC`17h u=YO#*+|?/۪J~!rȮV]\۳M &A@ @smC  8ؼz M϶?  MCAk( #|y&-FGOGlL }8t x1#}~5P#S0E xG~GҦ;cG_3|b5kZ:&1ZU+N2a6Y<,vm~|Y{r_]t7ۦ_6;(C6,:lfLVz|sB&OSu򀻭~5"ϧJk'rxONbKF(5@MNH92`5z}TBxEDl] AF2Qk2 Q uArf݈n|\ 9n4a\"I#βwJ!UZ[mEҏq!tQ33-5"@T"qjsT8fHf`!$JtU[9\6"(n+7'oG~ !HVuR,Q0ϻi6x 18CJ`VJz6!Ϧ >Rod.< oݻ ݛI+ 1 S٤m~GyE"3 y^x9ʕ^"^,11w >.ĻLN*RB ޒ+l:|ë2F %{z.SỤ\; x޸ 879mVQ:yR|\M ":e<D 2,X$ Y8E<;%]O:M$q=z>w|7B}m8VֺdaȰ$nmLT>P [YWiȭb"! D-NhfqU:SM "(G]@,)62vBסX?q/{Jp0Bu$= hoú,-alD:/F /Age'.}LəY 4QH` &ɫ@x.4!ؤ9B$P @HlM6rP$̄Hi$ )&\ a_WL3,.1|8*yܰ:JTȌgڍPc]E]P$s2H] O2I&ݐJ@ , ~b509m}\23BQ:'k]ôbT:⋜TF [?h h[bnE((,Xijڥ gZ&ɑ#u@1 QQ@L(}eMȐN}9G$z}eI O:Q`zHHI`HCM$pٜH@0I($lI?OSQ c*~'?cIjdaײ5P$=Cj{a׌ ƄU-WV5V_Q!mvؘcdR0*RS;IHfcڧi!:F q! vl I$!oRWnS${ H!C|$$=:@$xt$8tt ߳j\Y;X%$Ă1 y@r71 #>: @I ̄{I9I۰N]CoT m =@HkNՐP)M!$ >s6GSLY*2$ds_ctrw밓sF̛;:s$ćN@pH $d dش:yLמ}@D{ԈskgrCr:]E[ͮmEJJQjiT5geIfwz[k~-vsqx^p IbBTUP0C I`KKQ0'>O.򍔦|u\u;E)!I$hUy"N\9L~Nj0+XaD(X jמntcSknJQF u5urlݼ/b"k˸yM^KojPF1#GLryi-NF^Hom! B"(C'0 KU !{{ZzMްAv-C׾'گu| w/C`@qZK=T @pQz 7:WM +@B {E"{N=XSnN'KRHLHN:nq>HfH@ V($?Y$M|I $Z@> y$nONHmEU- *޿W}.I8C|Þ"ABEtFL$< C%cٰ3TqLI7su8@@3QX'Q ?*[N+3vAk}'5 dan]I! =KQlR$7qPF,1bqٮi1)[{HǖYuSPHyꐂ=!HN']v8Jw€)b4bbir+UDzrܕM.jdBI.{ :ؼTB\( ֣'7~TN( -t/7v+P4d/ZH@ﲾ§ d :KXH {o>QV*Y +A)!ºP@LqyNeF_an 鼄-}rbuOZ yKFفB8o- t`_OZ=c@| %aDWw-W\K [~ACغ\Z uitRqEfF'lqC/+!"֛ ﰂRbnwy:Ȗ<]/5໚InMr(|֑ t+_pdA ǂn ,b1 TU>oEz4 Jw}0C7i\nhpӌDӴP@6-rYņByGHya-bv NUSʊ6{7R 41W&,@9\H[`Ȣ}pMݺ+}ZIp#LL ^ֺy>חw:^uΎvy/;x9)elo/םx7nKVi!_~rNn%d]I7dw kBN$Sc8 (55ܪ²Cnw˥r]³t(k;{1&̼۬nZF<*9ۧ:+֕ UͻgY,$E&SFﾞib_o_sBi0S2H# t/'B9ʈF  C!qsULm<ǐr"a AI dff 7G!pvgB 2O9 9Ӣ4 A z ,&äMyU:;*cVb(ƋBox A !fOye+Gʁ5FV& $*41M{q ]/4YE#)( `i@bZ4m#A̒CȌO%'5Dm&VQ6n4یwv3י___܈8*3X5Ą:6I`I3 50\U5{bkk66اRrBNv;R$8݆_Qdy= ܰ(pY7Gj CFyֻ] DV(_X"]VNC;)d8(QS*u}F(UZաV /$Fm;^GZ1!uJj‰dGWʏ`dX"g<^%+l9 D a獓;uu<-9e^Sǀ[icETD]]M jt1eTFWaq_y q'(dh%eYMj%ni"^$9㦑cWou~ ^Qe^:ϓ7}Qgt댘u y][n"Abf$TX@B4dC}RdV<"Y`FyMBJ~:ntYF,c9PHE/nG~-,Y"=WqSut1~h'fi¨bC^;@ȱc0o+XH)C(mfM?D ϙI׿k[zP>~__1tv.%Eb"ҞtWKs/J$9CaP*.r mXiҡ*E0%|O:gx6,k,AVM03$ aṫo]Mc+! ɶ^-X ֏T>Q'a n|cؽc"v 8 bCg 8d·ݒ'S *#Yj]qvpƹcuNxD`D"0"󯩯 ,x mCs#zUbJ 嘄)  :LJ^Osz|oW^/.rxEw:(T*٬Cn`J!ɕ\(u9lI<4?ݯOqObu3,iO4%ht:kʛt U,!-o ($ISRr!8 [(kQnyq/⠍{::frVޑٱkmuA`] yqj;۬EyTd{ wj'|(U1X$QωW;}NSB)Н/mKP|qvUPHSSޢg5n5+p"r2xyitj= 1Z/Cz7梄=ug!IFӔq0qY'Cknz/ixYx,nN3k2O%o[/\}4" IKu+u~@ 7z7L(Bpha[!O"jeKՐ,(r jɬ>G7/{zbyȣj'j$ MdAw>y_y`r9TMMߵ6ݐg9Rk UdrC Snx˼jkju'M_J>ԻP=Řb##xxܿ'2í5=< 2^/>Cv]R/7=~Mu}Yt%;~bȊ*F* ۤs'1WWnZTw$66%C!̨L^#+C9]!v([o?-#](׫?om% h#F*uL(u>. 4+Wɾ<.]LY߄l2-xDNN7FQTV2(~uz$Hu 7l]-7MN vR}.a=[b0q38Ͳs s]xAYCa)i%=ؤݤ6#_q[qW8 .쀤{EHPDcAKjuZz]ujunP:SEE3vmwݡ7T# SRutS9 ;RYImTUg:7kYϫ !hQjfd[,#RQIUU QUQ[1Sq $t25F,p,cx (PUnWx(M]iw leٵyuu3u\g[;Mœvخ6k$KLsw%{j^8p-*=$P 3o |2'$ڷatmº:%!_,Ɗnqb`EԔd IcYD&BX6ň*?:^mEc h65kY;wYFib>e^ (}.=5LL<,>4;*#=kJ -v' ҋΜDdA"# b*ŜxN3<0@i!'n5Dj []ק/oݧx6$H)C,R&RstN;huSr)q^.C[ ~9 #@-}_*2AKN{ZjFԀc8Y~|\^1t. 9~*aZrqVn-^ )ke$<߼sfA $ e(;\ U %R&JA D8bN :IsY i"0XE?9&cbɊHYBt(R1.H_ѲeDR$a$nĞs7,72 tSRga2C 簮_c<& T Q (2{w~_AF3Ԝ XCxu7_g~ߦwJߔD&dTE7c;kv=s&9& -=xl38q_)ݝ[˖c,[bV]>$EQH-AZ>bSDQT˻|%:Fj/r GB=0P[% HeWFvUp`A!G7<CӤ$:NT|hrQ.>Нn!BXq@`x5Wnȣyo]ɹdΏyݬIUBV|wewW}7S7PwRڅC9& !⬭;LͶG[d ^_/gvtBS Jמ_呚|207{Cdޮi3d7_m@׍{ޫUܳN/Qݥ%2v]_Ŷߙ\Uq0Eaҥ&`A"=Q+)s0':YZ \b7VG'sd7)]D-Q@oq;~(iE_aSoZFƤ g*=m>-K4,a$#$akr kkL'aM!Iyk̐nI$!M F [8u&Q`a8uQ)"P6 PIcMT"N\6n&@ˣ!)! &X&!@$L uܐ,2$gnܠEZj@Tj-K0 .4FEQ!$cű]& P$BB&dOVg%~& 8u`f@M f@ F CHI%@pL Id~[&4"CdFWZ#6  By̆*II uv {USBI wNZza :f C&E(E QUC ė0@&KKa$ H#$8 HK! VօU#V2D,3d'hIs!lFŢW;rinskj'+7)mͺ4ڍMuqwqvG9vjc53WzFԉ뫘볝9hy[]Njshںmr܋{56l)M^&1}k[fPbѴ[ggkYIrź6Bkhs|nՍM/M-dMF]\PmW曭!˴GcwRWtҥpa9hm\رU˝9t1bMKp'w66-5ݙkISnK\u]ݹ;W*N4m|uש_Ӯ=_F{e)*PyEeЭ )E&BD9 5D0/RPP]Ȉ!$(jNhSۓݜsrs^Dי]wvwx^9TbЂU}_j%B Lc FQ7msZU\.J 7f.e zMg IsIE'H 3$K V PkR@{9l$B֤(K$!HI!@D lEހ@%0%"*pH!8l 1] LS Cۤ!͠ $ \V*$ͯK B2hqR`\I,:D$B@,l4+}4ww|^8][jos )A2Θ'8HCgceȩ!$RFxjΉ$D8 tI EzgknRI_rMV**!e*c$2Fm\nٹb1]W-չ}x*95iW |ooLkƸ7z{wU*印#%%LL"( KNWQl(1̘ܩ s}"j4i1D_pWZL bICll];E;-64Z(rjء(0K$Zg*`!,?مU,€Ra{TM/T* Y(Iz7]WT9v;Dg%JPDRByBp%pחٺ_^w K `$J_^fDe2Y@QVIahpo5 bµ|:B(S+סbJ*\6ו$HO F @9wQ~%_m{6Ԇ$Q`n)뉝}qP&`jvj$C3!$+$#AmA?T1bYuW3rB@j*@5E%D:b/d$xěY*@$CE&@Ll"!; *X$55o?WvT˅dǛ!Wb ,솜T `I2hԒKa$ =Ӳ@!2*3BI,~ږI&'IM[McE-4ͪhh5mvkttѮP\eD(jK6wvۋG9rgGp/nBcIkJ!s KQB`M}4iU_Vo U%Z,@uq&f26haks̓ϡ:!y2\r |ڠr<M rb(l:O+RJHE%Eĥn7)D  (:rE]W_uDĄ! `t6ΊDR*Ew鮒KD'kdfmDhҡo`2h2& HY!I7(oU Ll;"H`ET֯.ynp!RH(,H· *V46 T)!Woֻ{Z I#d Id$Xgl%I%d'uє3U @ t2ȫ%HYJ:RY c4h,cahֵE>i5S*2aeF#}Bb0!jUQ\׷\rv7\ۛ{{0k\xo6wW̾)u LHhm 7\5u Hw,6QкQ`gHcLwhc!rUYAAT0LMR۪ʒL[ q4˨Xig4[%nQ7m|f344BS dSIŅ\ Zub^UBbqZt`ey$%]'oEŚs54%(ALȘ(/&0mfI'=dEִD6X,4ZKAHWTAQV R!$:FEA5QB娕D2` &Qg J HBgނ2ŁwI2  *4@12 ,pfCYLV1I,w G Bܭ}H$$s++{H,f.|PM$kԗ GBJGC:^jz <{UIn%A4 šشI2S}0<8ʤ$t;Չ44]t6Jiө Ԓ@IzV&r0v!A )'@0£@)tf׸[⍯ds^<XbI.LS `,%) ʱR֨͑po‹ -M _x~+Xc%ܫg+CfT8Ub(@X^ U+PD(WȘDI wER,\ 0I(eRQHC6qE$RRk/=^܁iDA;s"P %}  aUsl/JNV I QD`2Aݲ[5't*f$,UK{^]4XiU1U JJK t*~‚mbwXh֩T4TUb1U5ji~fmPa#4dxSX 1o)ޓhvLΥRI<ڭ~#JIq0+IaI ܠ,vI,l Eh"2@TrӰ.c5JH4^[^qk7Kf5Ces3A(lFo8fWsq+v#{GA`NZL }퍆qU8?7N4ݻl D OzKb5!3E2.km738uǑ}}M4qj[MB\"kUy9<[AEin|vB2B@cX39Vr1Q*#MF# 2oM|; vqCTMmz6dlթ M[qb3jwIhB A ۽7W{%<]^n^緳6Gxפo]wwr") ڃU4o`YQrŠ]$Yt]]3QGg$$#VUlkD8U#M'HY:" ]4]$rV;K%jVnuCC#Loj2]{RT |oqP5qyWe i97p(NPM)dkY4UQb6lR-EAW-ax$@]k;$}g=1'r`96ԄLcUEIQi1QlTblHe66LIh(L4i #d2F5D-=%wW sڋbV ilRIYddM4֓j5zt{J6TcQ@dQP-n+۳64y+[YxdZ5z튯RH r\CK^3#+eͱMmBS`%Lm&0mƦ$+E)KبEf`2VM`J̴ƈMLRZSr̂4[|JŏP.A`,*W=LvmPX^)g.s3U*Tj)uYBլl6^cr1Dd~*tԡ¥3*Tw7N.sɏ1tsk+_D*14D)gQ<<}/ n6z]LPė<{Ti"082V[\Zހoa:G-Qt`9v#œWIڶfMo|b]Ai@BI>GQ3&ή<Ҏ~?&{)(@K:0LpЈQ,R@r"930!RU ̘w. A 3TD%< i jRŤU͕ { W\ːRK6\F:.D gv.ȵ^x뗎4!-T dDi,zjqB)RjĿ@H esyswKWpz w\zɼU ufۤmm%m y!`$"Yp"*ypJHV]ECI.‰8 HPsufDgܷ˘Vo[sϨ*AwYr_Fq]g!kNب!@ :29(jVeH6ĪDBTYȘ8Ф L/d d <,(%vx\OzyNl4/VX$pjL<E~td-TOHqFo'"dqf=aveɨIuCc^F+4c0nt[QP׺FHC& I&5"f*cd.@{vqOWE5 T@WQr>]XgsY 7j B ̄,zիgT S𾳯LtHHh2gF?A;K"b1SX)ȗFx >_D3-c\0QcT0%''kR-@T*JEZalgUfֵE""- VB}]#xD@%)gHDc8ל7uM[[<{+,eYH,)CxU٘gQspRr *? 5g''}ak$7 :xKZYOߠ7$3> Px_uG%E,lUAC=)rcm3w{?jj>-Tww1_ε͋K}x5g|P,BhV*Z L4EM8OFT07}}h k{(:5a]nMhVAs ,d0M꭫,ֹXjCݾfr\0XVsFh5)C: ^8{BwEf)4Iէ `sZ Ey''bQaLһ7Cn@Lj%e2COq~P);JZ&}Arn鿵2YiYy\N^w=1YyyV 4d)w#F`۳IU;y>m[ݭi=m"X*i2_tp5c?pn,.2ue])rZgUEs^o~xEr}MCoT5<#Kn&VFGr#wa{^V7Ue g% |{ QPO\׉#bvNa#!.c&c'V >5=߸f}yGB0K8vCuD7);âPA 2"=_|5+?dz0?^ʼn}v>WcO%nK!.oSttv# 9bPvϥZRxV<^{i5HD~wŹ(`n}.b?xX8]({ڏT5wڸynݿ6m/}9+CrXGUeCp,,,˛oO).A) ֜!PXBLBNw=tj6˕<$64 *$qqe"n5@2q:JoBr/={]W]IghYV=}ͮCxLH˲$ 0R~p>Ȼ gDgFt_瞳N|;vVGGEq2X`T z ndQb XHHKgb,C>e^Q5Ŀ^_̩WNi5qh.kdzj 2RD=ʙrGqJ"\@q%Ox͞JQICMzF%=]eQD~)#9 l"יBoP&j+_@mVt1z,Z}jڈ^S\ĪSpv⋺48:M8]1=ſ )esLW4XCٴQ&l3BP^:n0|) #l ȨˉˁZťk0T37뮶_]Zt>6..\}N'\x% q0$6sV.W+H(c"̪!~|M #\L{@3l< {Ibe uTI;dt+xTG_9xѪ 6(vLLJ?lK\90Bs.Dɇ D cv2ܝX`f)vگ(qf˂47*$AAC8#HTF&OQ>6`$ 0 ׻<Kӿ d1Ť0\ȬddljQQ lY"X֮ثjhշ5-b5+kW1#ĹqY614)|_YX~^cJ2$D"$  .4H`!PO{ k҅i-x}F;eR6'K;I\S%2fgV,3y!m?n) )e@Z/WT7ҥ}M=?(_: 3!KYdsb3E0P5΅dt#ᇨ),n:WMഄ{6M=ikO'GiEr-ĶsB 0N-"D$:)[ LjqɡwN R/nm׋vD9mD]Dy;֓=)>Zq1Ufb.Ab/K|?I@Mi(\Գ]9hÕN\2]K˽T.,~JV )`\X8>Mi::F,"J r*۝N9?Ç0`\vO[>h>J̑ PX7 .%jEuf VuX1`j%zB1|e;abj1ocw<ߍrX2*ǏOs!ymHZgШ*Q 'D13ֲb=&J\&ˤv"²"1ehD 0 ]+|L 32'(ZQV!a$$,}Zrհ 0@c c.#TP{k+ #d/;:$.]f8zɀ `(f$ p}c̀14{ry%s0"~o.7 .#PƁsh~eO:JB>Um@B;B G H"BtֱgD1`iI-Tu]ϭsU ,MF5ʱ%Gh ;:cKuQE^R<~xݖ2Ȃ0 mcK5_u$X( `,o:]yhьUEds^{7;??b&-2yBET5uhYN~ITXk:(jgHbEV#](h1MCрcѾ*(ņӥciF*ioء" {\TdP}4 OB$ Bx Ϯʐ4RCg%}id_sDY!~j$CM4,]~Z@7HC0BC) l$ !f2s@`@IBEIHN7kd @֤ m|ˠLI:Ԑ&^~ETCJHY3! didʐ$ @ @ !'I<*qP!'pLa?Uhā$dI j$ɥAw6B@ 2Ca!$@q5 m! 9B07 $oX@,$Y rC;4cI 3!$@R@H;~PD$m pHBed̅2r*|I(I܌\aP Ie ᰯT-UoLo@zсL\B֠$ zA/BZ}UjFVZjZ^6J6* ,?&A d%w綸00@❏X!!!H(Ad5Ƿn8T0R!eS\xsSm~]t}ם;3Z| *@5޴oM=-Zn/ !_V#=f|8X?^䣬 xo~ȹy2g֚KW4`Χ~ii~&'Iw\)~Ƴ]ɻEXh;{> \.wk:sYZ,~}rS.a *8 _% rL:5/W+/P{ߔFOO{)Hp^S.Djn}=}[T/uŠdng}7&iAZ&SksR27\stv}/άWzsodwX ;6u֫8czz K{Qda<ϻc]3'4h=,m,{FS?;b{ϹNCc%~VL4]C1_w^J '{J6&&v{lmi{3Kn-"v |-[Zoi>Yz3{6`,%0EﶩѱnO]ş^]+ ݸ> 2~|GkvJglubY5?iKR폽$C>rԸߟޞh3B |[-ib@vC/gQkM$h?)4At+>3Fճ̚ ¨ b'VlhK9WAq;"RvP'OXqX:.1#pNH0]R KyʘN"A\$Ȳ"f0ޫYqoX{>z+?7஦G 69U +4=,ne7M/[OkB qi ggö́ OeIώ+3f՜( v~RS.}tCq*J[ד:뻖OC635pX &/\ŋw|5к˧cCUb&%YfKFFaْ$k` a$Qq_'j1?'_?@he2t_ `9933XPӟՉfV'/i/H^~>R8,kd]{P&2O;<)pY2!SѹloR#6klgk@p5Xw0nc-zTܗ\ϩMHtW P;e+V&Gfazoleh>~󗞜-`HZ"۩`L4nbׯ6z+f9za;qWP"iz޶$fG6h7?j@aCA@|Q!;-ٳزY{e'09+9+0P6!m%%Xy^ nONJ8IlAZ>(s:qv,|8FoPQjټ~Ir.v^A7yJ8e7 1NZ5 ĝJbS ) >?paѷrj1WF WrO'Yѷў:>onSCD,t2*vԮ;ÞQD}K@0Umt) Ҁ?xDqQkDBz{o830A 0ݐ+s(kܞH4Ⱦ)w<r0VI1o"$n䁡dΏ*V9q/9]q8_*YB-}f@ Pf#G溎TZ@NH\;.Se2 F\vֱeXq`Wx@OUX OvږׅfIئBf@.{w_Ja?0CؠH zǕh$C}}_$ 02vI i_ynP @ 'xBi I Y$K@6Yvy& !@,$C>tP2@$'!l$$) (`JI!]xC$ d!& A) $,B/F0uݲI6CYR3=BswDeQc:+)!7buL{&y&6@ "glO\b`XazfurMv,^<U$ i!qRe<ƆuZ8zqX]R\(I6DbV^9Wf^|{ln*5һ_/;n܌ң>JCwb7|QG+{~<*_w~#jG?CO[QC!lGcWg8Z=қE!-k?c~^zz}'k0?e_{=|_fx RfrY/AEik1sowj~|Gb6_6mbm2Vo>>߻x~t~ߙ(p^_Plq ~ƩK`z"߸w5ￌ>}syek^Asx-!o³MU \ZN$}-)6cN!3|?A,"z1AQR>R x[C¶]*1E0e{ N/ьqizurp=/+׳l1M~)sOW +>U;]OEkвOjP1H55i}k%I?֞^?{W:q9"jMZ6܉f~Ᾱ[v Wuw3vࡡ,eL@6Η`,si69p]i<{4U\a'X_,:hV[!8Sb"8v ;7-2]$ w5?,E˩Y0LTl|Pqdd ~I7W<7S>re@y&Zx;0 b|+\tظ m:q`5I6ь2ƹd <˃Tin7 4ԛIL6~y.lIN.k~"k0;+ٛx'C2?d[RBXBӽCfC3l!${ $ CkWzI O_ȿt3 OZk$%! FBAdRiԄgXa@ Ph20wN0v3ڀ 0РCܢCߌmk߻ O%?hN3ɐXvI!&sI x S) Ba9i Cğ슜4EH@I;7 ppItoöŦd{!>3D 2F2T>]r k:α#]w޽M~NiK15/`w %3 ( J 9}{}?\[^|f:C("rHi]StMu7ܙPօf=kZ?2\`m~&9}Ͱ OZтCUpH_={'!`oѨ<>L( :(0* bF`uR )!|眚6˘%b]V5^MkuKNaQ朸$4d:Kag\qr_C.&Z [̭WFﹼLcxmgPҜ3.nqk*1n4.n!fk`7(NSG;Bh){scCoOБ䠆Hϣ8"5$2A`/|n>"EQzO"ΛWwG)MoSߏ3fCҀj_c {EƿL+ĎbAr7X#'ل^+"xƀ' j@! js;ݽP{j؂Bx6Ff%vp<q5)e, ʌǐZX#zrш׶.GK~ ~L/=SsΚ?@B0Ć6i"Aaqyk0$e]=~}CuBbI'Q^gvl } HRL Ϛ`%ZZב[_kr6\?P#Jo.fNigHK|9K  NA`9 N(h^'rǽ~~<2rk8qs' m! $Id!۰d)s'I ,}͘+d'oP 00c fE!?%5r2>ƠIõBH u$:@<!O|Đ&a$I:!d!f@&kUt^L!K<ZƮqp aa:>;\`6jWm&Ԣ JvbO+^K8_ =\&迳;FOgj=dF Zg\I'$۝zv=|xLC5ým xdyVsĪ |mv(I>֮PqpN8 x~ Ex> ܬ/dGt H@ @A ۭRNA jwܤюb]x,@D7($˾ռ$0C\W/T?0^P :H}6KЋ}@! Hq![O|?ȁ$ HKЇ; R!>ɒBOm{6-kܭ~UZ0):;HB\=?䐲,'}=P_DlT෠?z !2"쐞nJʁ${37x9D`&"F>?9łc>4 tNsm}d`P XCdCJ{VA  [H&,f[!_֙w G*+յ[kafO ?'!Ҫ_40<&cBo$Rn VpU iWS tQ݂+)Uˇ4/ȉpc3y5\9jÒ bo )I*~;:k`sTP?5U|l(Eƞ9 pay=I4$4}QEúzaM@X"B]o&v$. @'mE|Q2Y&I!>Sڦ5=Cd+Z)$CݡГ$̐?O&A$$ï$$! wI⤹x*AgYY'B<mgaŏ_"(]56ޯpf?=63y}rOɤ[ v=WxAPF+ўi;V}t!/I)FL:81N׏rM0B!fgh$NUqv)23;v̔<,]2lO9fBdGIёy'ZKH3=1Ҥ_>ױڛR.C+dY\'q~TpZ潶;5r[Zw9Pi59d.HeOԧGMt[ҝJs[C(O,ɹqn[#\SGdK"TFQ*pAFsgU[C!\tq1uɑ]6Q[nd)]QQ=T7Vj=7H:+I2c 37p Ktwl˿nVŬxD2~BD甪^>y$ouڙBu}Q%WjUUY35x+\ҡIw,fBOZP3)CZ@)"73}q9|Aj1qȿq;5pīZRօ[,gmq]{mC'/6tثY̧pܻncÞ$~51 ]PoSKsQu B<=EOO۱zg)[bWu`  vw@e;a" w3 t2:(!:qk 5HGuwXlq&yw*hc:2_y%@X<`!0gp C7z{߱\ac/쟪vO`y<&'`ej9Prϯ1aqnp3&*c$ǁdmȁٖ$ X#< ==ȘCҚqX_ϭK$.a'aqy}7ow_ EV34ڿ0$z %[J0Ȱ3a p C>hc ޳M S|g[cyLWi%9Y BN}AL @4@^v?BHM@&t !o`HO$2*%2Lq-%Fߩoc-Y g5ܙ;VڕtoìxuѲ-W>VV~o/9rOPPiGw~:-be2O`0U. )O -1$Tŭؒ= xH($@{, K:YTpII@@O-FpQۅe+>c ޕB9_e[gk`ԥ<imOgK67?c~Hm"Wm%)NDkHoKkN}rw.8;M4'{NsHedL?V]FFÕ~y%a#FG`".>\G|OhgtձC o O6$=I8,Ƹe@,HJ@D$'B )7~1:.L'qOEosUG5>땲g 4 ?O6BZ|&kCy<'ռbIưCu/, (7H^xI7+NL,H'ǕNMH2~&鑌H{4{ϽռXI>gRzvi:;yIkc]>G_e~<*-Q}\K*b^:moie۟{vk9 &XA$U I}-Q 䝌f*c8rmуXX/n@3@'bsWm5Sj,P 9ƫ3t_[m!C`$ lTc|!Mn7oٴH`sHpmRylU!!5mrZM&: 7>V/g>t@ @L,(I Wct']juHnv7MN^=zqPOh ]5\ټ@̙~YC}[FMc= O0,x' vɨ{00At/}ce%C:1509 OjKӔߙh/Xs6Dx]EL4 |B0;D7%2e!/n͢ʕuP FԂYSױ@q zD5YO*I!'0 B,!ذd~I$4CHbt/VrZ-Z~6LDUI=;[}tkb>Y0AL}s z-ad;ӕ0Gcdu|' PR15?iv엏{(|{=@?=#" b=6927W.a벳ndCcjDva+ "/b'0qV6]rLԱg-r]N^Wsma Ni͆n;49t=fYprgܨ"qcbs!!I0:-M m&>qbBJaWPBXb#$?[mZB}4CrP#$!C/_FZ ϋ}gNn=< 7˨V!FeKE${=cHYTeseYlZZw| Q]LMR"XVvT?\|袀" P1:DŽQT] 9 aƪVkVP{Đ+f/Bt%]ޟn)'zVCE40 g'm.$'7Z8]pqQ؞֞=_5T0~9 + }  tPD]Uʞ+{ -\_:[Qt~0{j| oJȉcH`deXqv)v]W:t ٝm,+}u5?u~{,0HfIBR@8.I7դgX 0\r2Ho6!C"2}CP}[PF&7.rkyV~YVf}>Wv`VF[#*GQk=^jnL[ߝ0.xt ķ&C0;־ɁĒ̚ش> 2Q30TĎ!fDG{[3> }>l~.¶/Lրs(Ё=mD֞[zG"cv6{*LWu与^/jO>Υ{1x(0t`҄cy|?~c<|M5nZ6[[κcQ N OނR07Y-x൑/Q/_[OKle}8/g. 9]v^lֲ߻ՍJ_ɰJ8)K¼zi%)MIFZ*haxeմCUR$a Pѡ? R,N_pR(f/=}7lI!?&:JFOn^Jep*tK&{߬ݑ쌙y?E)S'Zw~~,FC̰m˩zT3g\~s[?̷W2|ԵWjŝ3leM+[=cP>jLfgFIZ~{,ؤH I!&6I!wBNrHѼAJ̅a  /co{KgS \6aJuRkҟEѮ?JR^(عn[ k _̡hqS D#B4koLo2 qGy-f<r_6W^̮F$V: N\"Q),| sk[jy=Qe 2tY>K"tӽB4ȰfT{ = nɼNs|'I'XQ9 u U~ oŻu.@cd=BLnjd`C AH'Oa%L${%3OOU&GI,%GB 'MggI1h!,BmQIs' a9WnxCcȨ国/T@>3Vy_Hݶws6ۗ͞H|K`)ag*BwC6ҫTM H7%tN:> A6oq[ūLع:YXC7hgD75YLu[b6ٍY!`y'h<ܭ.̰@7`ȃ{9.t) +$ahX|mϏdD#ٲI{]9H:/>¢`QTpЌOlꪻ}X~쨤.՗yݪ^4ohß}]˖߯ڻG)KiQ#L-G,bC b&4"t^tַ_ "H9 WUp.?wJe؏|bth钄A D 5/CK-(Dpcmdܫ㓝H8o$S숆K$J%XG^r!P;(]wwLEZSaD.(ut lX@&Ȏ_J(wv_Y 7zl n$%wv íǙHh|+9h &Z(A\0Q$ LP m@[MyYa)Իcc QT >g_1.0Hb'1Nu2<-hVSߓTfishR\@Oϲ,8;yaSItJ\1Rɣ2dFzSU2E4:Їl#RRi"m:K[v0ƫWS%LΝxm)6K/6Ӛ~_.nZ`L#$sWk6϶\;&j3ۂK-G99@,0:y =HLaGr<[V ip|wq>NOuz I$l$0D{}@!O@@'9&ۥ{GӸ}b42AAڅSI,U˭ܵr,,&}j}7>j''ٺ*Hl@7*o7vkѐY"\y<:߭읫F aͷܢ3d=;j1eHzcp-VjU|VeDWXBc?ߊ B0$^¤횐 R{!,!$$yUMT1d=鳧^0k_73a u:_mi0BLh޽Tef;:G9QI"k΁$A¨VzC@4ޔx;FOc5ɱ) Ĭ 'lvq0o{7?4R/Mn< 2#< `_/x; {:a\]y pec%إ(D!q|Ph&/aJ +._ŝus(Lϕ˳?uLn\Ο34FM*C ^I)6j׻adz\)I'mǺTOHI-x i|C3ȹY!Oa۲{S=K?~3fߓ_6\j+X$[c@88}r-I2u5eI@X±Fi-}4h\K T ok-Y=2畩v۽Ԉ4¢JKcC]"t'i7`LlA l?V:*R`C9k3uwub5p%qLoF3`k%zl?|v FsZ6TcB!lӅW@LwDsWWC  !eL 0 myiujaOahv /҇k՜kt4ttZ|"D#j BY#ጻ7n,-8yYc(B<,v?T =B',P[\ߢ9N;ck/aϯh!-B7䁼c @:G{OzeTU`;'K)EϩI@U%,kyH9jv rW{J$ O5ޮQ]bآ{PSFeIr10XPx!.D(>*$ЁT!/i*Z5 2=Bh5/ќ|p~3DCu{y,rNqw:θ3+djlW WGOi aܞ:t!D9?['891&_h$aN tBI\#K_iYڻ;}C4 5h$U w$.BO@VFK|!u!91bgu0 g)`mb?N^OCGp~׬N17!@ڵ&,O1# ڥ֦Dp" 0Uw'VJ eY$K=LmCuNZ>@$'Ύ ٗcxxmWI,drw6J[e/D/==;g06>cOGW%;b?]:ca޿nzi!NMEۡ=Ct!f:$) 2I鐒Y2B$'2LlL~v}Oq|?I?9? ۿ¤}~jymc_*6R 1T~Rg"b\hu&p+s(1S%N+E~-/ >p= dʲ[lXG2GhG2jfTrKh, džެaX_AF(!}Fui ))#D]]dMܵN+aZy*W_&mp IOTL{tT!-G&)>Z3}ԶDj)έ LOal3i@^2W;TD2_1,aKQnqe+:L+̶I12DaE"8˥Y,Zl);D>a_Cb ` ^˭ g cϬy`Բ(Ҩaq\];->:!`'<_}3Z afMB,B`DIW MrdDR&d?VvVZrÒZr {~?oQ;m;v-% *&[IO.}XYX0QY:|&/Uu;⸡w='.}o?:y=T)iX7=Z!ɶ]˷JD Acf+,\ \'nbzqcٜc-  p`fdmxT(M8ĺtCې %Uoؽ*)wLfż#__Gȍ oOЩgߝ1>N.-db &qdGJ Z&Zl!a8Fޛ=r=RdzT*b0w^UPEq`xm"Q>QYK}aq#NA2`/j8J`G4ݢqok@L89SvP"_ܵ)LPr3^v\r4n1{MuHn$\cRay17+KTne0td5 E]2#RTfuKgzTdM"QkZYcD│RnMoYU:t'g17&Jg*^%-@'TE헳9hm !ry1&/&PNThHGjH5|Sg_u1VzOex[{U=_M=3"V`wOy,Yt.mKs#dB 7ƈ)+i^c=jB-6i @({Y0b0Pkr B%pB"D-984lX+(ɚk\Vm작:쮾aЬ-Le*pMywv`zsր0+C,^ѺHۏC#䥷0mkNeܢzl$*,ĵ5݊kK ^Sx{baI8;5P%Hr9|س>ݳ9(bnF,/N5T6anjzSTrQ@ Jbb+w#/mUI𻦵!#tݞ  !,eh9xyY֏ lTr$ln?5x?zpPw66OiI\1R-G"uG_bE>24gFLxʦ֭MA^ք9^|rvU؉R qZX5H`e:BUv#ɖy)e5#319<׾[|:{A|q~Ly$Pw6O2-ZNSc{40l_CND v=r)cEmi q}O/鄼H[8!DtvXn4$-K8&(X6wcj㮢PqI>2h6˔Ts#ҥ1FZOTE˕+R_#t\.ͲYpaILcw2{ @r\ぽr [2;ȎXm~}(ۓxҵS}gy34M3Z4vG)1㚈";@/;ɚyU8nj΢Cu%0Ռ[{ƨv$hRXG";pT4iؼz LUq߷+jCUƅL 9~ [Cơ} Ám/8A '2`cHX~qw`5E;S"CdA&y˯>^!"@V;A eC]j!d- w ?=WAH;e?ns)3s˺ITf.f9fyW?ۥ_Vq>Z( Gl~vNT>qXG:5dnEECѣEdńD  3_{R z67z*K!] Lfl}iD!LW}mje,kDP4U17n[4eڧAZ,(enڒ4B/ # |#<'نLކMg\hZɗ}KR^ռRs{6[3B36.2{n A"IZl:[{__n^bi"]T`oE211@ ߧqB&f!L› !$%h_'k*%aoog7?#[TMwa$`@uzVs0b yY[Dם\=oULv.P>Oo$/.h(ul @e2~|*N+_Bt sLm{*>HU@zżQ=],Ns@~?됒~ (%Xh8Y\~>ce;>$YҐ7\7 \!?a~s}nl$y>f~NvtCxـpXr5 zOTܰ;dN[mR:Ǘ9g|u|{R[11H D}` ,!'H/=u@D I!`In5L)1Gpc03q{]x\Z @&{|zdGCeCڙݏ U n,>9< @4<⺻@:=[t#sy";#7ccS\01LrlW^t*.]Ә'Nz$j$ ?sn($3p*o؃t*_00`& }$I65 6w0-nI~-ʄ9ԋ3tN&Nb@`>p0OH`c,_Ī4r0KsLy{?WeA= fEKzcL&(w]`:=DڊDw{3q4ҌK+*݅"j!?Ar$qxf%  ZÆ{!R0צy'uf,|}zݔ}}yOg5;ڄ_%}mٟ_mmOUO?v9!aiIJI8̝k}%wd xBxL7>@DT?0ma1If`|*NgQ? . ; v3Az }Yj 6 =}3/w?'_b[ A`!w`KYlg|zR\-% r L7q{!O>WM*Xq^XuZ_R$$,I$&TOyjB{/E7c1_]벃%D?C{ Lxx CL/dj}!|  8q}Hj B<(S|^n'G˫’^ 0 oC_rz` -}Z(1Cؙz] z@HB@<C f$ڷ/ܝ/Bz߯o({RmP+v *C ޺((KU`ehǁ[bGex;IHS]H7%+6'RR3mlzH85b00_%'#KU` 8!'YAd"#ޡ\=ZK2OHm.4L4L<_Ơ!T%zPiA SmE-vnح8Js =6ΫyfҫkDFk:T#7kCl So;ټD ?jpm0e56|5^Is@DnŨ5;*=ȯ]d=rɑTk^Gqr]Ud{8GAueo+hMBȠH~=#fIu2TR) <l%8;> ^p>I대 aM7p|o`k2'w[I~b.TV"DRmõta KB\8H9tQIABxfI͠*!MV2e2w|Kz&+958vRpBI$ˑU_@ư(rJ8y*Jy E 9srcɌECǡsCJ1Q/z[EE]7ElQa`rM*j.g2pngj"z0sT i2Xb !BOn,77IH>J='dN;$ YM9?E6Ğ?nq{k$?ym̮m?/Mm{}Ě`a wTn8ܩo? ;T|2+~+?u(2$Xj%뛬g {uoCxu޷|'̠oiو7qldv:Ƙ'1"i3۰G,BzBCH ='?RIގW_Soq|<^m+kJnOK8Fwt%&uQ0&rObxl;g뫼ܹP8R %c] 61,}~f~|#D 0ԐvC:1Wԁadx>ųY.[d ,?,<fJd1P Gr[j_,:5;s?G+:{AmR;uLr@XpklD3BP`ÆuudJ)B8B~Ey %D-,yl{l|S~?; p';^R @DJNU@HAg(귕Mӳګ}524n%:*يnd]`k.cʜr.{|,RxӞTb_šG+}UӸSYyŞ_P5MeȨ&@ЈOJTsu‚u/HϷkoÃ˓CdjđU;4&#IZ! \ }Zq#m)? .oBø^w^yWSW8ı*OSy0p>{GGp{aקm7?8 $=E>EWa}@lLfpj]r qۑ-*jyC{oեͥsݽE ?$\4HrQQt$ɔ0 w4aDP&vDS0WE7(L$k 3Ni@Z,tCb{(Džٙ,i-V5ZBcy$%@Hd5dKxZZ#R8kQ *U R *@s-X^+*d>ZW\a>1j~A~сu$ #󸅡(ӓD3<B =O@!$U "v!>ݟӔ3c=o9c/5iH#Qg,^1C- 5[T/ ʣ48axjۡ- [|=aLcfoNYTOM*Y|Iqz>$.j19nI+F8Lj mڶ ڧQ jTȾzyutMrD:Z"B@aV ,buňHkbSPUW2^٤{|nqVsPuF"TWBÖ|iZ^9`v4HZBѳ1b!tSRYg%Pjr~wAXk.ȩ'5,c2`(O 2*@*+(:z@ｇ87. )$!_tI t$ʓ`O'g/DSK zuzz}TڙOXXrP0Ōh_ߥa>~>E~;>IL Je,;s*@8$]\5 yj6gA#ۥ1_M] l<./&YHI"70O@k Qɛ8bwJzqn˦E O^R}L! \;vM X<N!HI$@ tUWkw}H%h+dPirם4U<n4!'WA v:CKw{,&A(ĠJ@1Ҭ/:֧\L DHȞȐ}ҙ~Y2V:-^Dv+ȩeiYi,aHY?֗(Vnp3v~KUͪ{*,AHt&b~ZbD^\¿hi-YmvJOy8MHO% ̋AD.Ar(abHB%@fd ,dO*R,TzO8\\^Ü=s:F?GU2vF]p.$PE( 1d\c즊ћlfQt.FPO_pIi "!p_mRfO6+#KP5yIo)="@!C F1f1ה6[,&@01`m$::}*t߻GPVH`0mD"C]`$ofw>LJ!nO(>] /C 'p#r>[W@"%xH",&&bn83M-@^/ȃھ둀870ޗ[:Vr*I&TTcJDC-r;[$:sw(H}zHnC2Q9@nE|/P0L}nn#!]~;@F&Ec6c/hk=CgUC^O+rU;˭>bMi3 -!PK ?+Ĝ@?@t`ԅ%A*5SB9D#1Pnh2Pw+D sm {{@(wnl2H$ 2Q"|5G2j ! 1rjiY{)0eYD<zKh\/nPЛN;:yw“-ԖU?̖BH7يCWA#HGmgb*0NЄA縯cmyo!Va7V; wT2ד?2)IŚ*[ f0N/RݳnV̮֏t2줪 UDmyg|ް QARPq.!UBV=ֲ!2ZU;{v?h8}dA!zVBz! qȴˆ R"t|4r pE 9V!d/w|W:?sœ>_smwi}w3Ǯ81}JP$2o^.L:B1CY<'p:K{[ﻴʅO"{$$QMUAa'%̐ H(_m ~~ݍ{h}9;a$}R6 'B3ea !<^_;s|GqynY k|㏜^ҷ0Iߗvqm[uP.pP[7_trp &הM2-ޖt]C''{+h?;sRQvw6W|K;"ɾo<Ф?D#n~vRtmaڶaKE Q(-SQ ;!#C?NCow0!=h8gxq|'eLFu'`&{n%Ir]9_/;}YL[/_ {٘b)<^o/|)P*2,֐2"Boզd~.g~?飵 F-8K9MN8n?9#=_;-qAA(1t \,vHd5#{A9ӂ 5p` }2>m"X}Z?!$T= sT@L]#b\9h9v-7}Ɯ 1л:3a i ch3QAس= ~MN##(Ԡ$`Z΢*M \SGi Waf[ P%.H&A:{OR:;٘ސAe`IK"k>%^IW4UVn8FQŠe7HBT#7XÉYT0WłPN-w\8ffP@=B j= $KsA$ TQ`[eSU%]viq>Z4I[a[7^ɭCp|En-@J$*`!O,%mqzbV^aJcd$`X@މIߣfʢKS1-=J}FO l,Ov8G};|]k2ih*xI"B-F$uqл՝M C ]_oG1"aD}Ed:s:PmYn_S?I] v쁹U$ CԼz6IdL7M|'w٬{>/6@:c$AC?B8р0:fWc>ioCfW:UB襅~mo}Zu&}{=&6vY*o}`Ȱ2>ºz'(^5Q'# lIAynOi D{1dƥ{\ƵOK31&1,zly-A,ZVխl h iE+i#*[S! 9?0Grm֒:#a6(q@^!dR*AUX;~YrxkYe9ٻL0Qo߳ǂeּ9b)fm/؍Dfi網=2)Jdh `]ul /ފlD{LZju+#IBH0>;{D.*>ځ_A^dGG&vj5҉L-NJSnZSС3;6ǝ2-2F-]>d]f{g9w:c#9Gd~Yjf(B6?`/n Vv>GWG @RNJip>gxU`ݺ,Ўc)Fx,Xåiچr=?}=Ҏbaz;."8wC{ ^/VZ}3 < ?_j T2 " kvn@%a;NoQo3|-~w ).e=LYwuICϩ\^z02]qPL}ۻ+h&NGt7ϵX)\WzO{̴&2ƍPu8hC#`T@0;\I{qy,! &>^aڳg |(ꟵBoMRwQD C[wuOQP`AeA6>FÈVʒI ־AdO`h=`Y)ao!+usr Ɍh J0C :|g#$ ۢ"D}RC2$Gk'6ѤO"w>ՓC>LRJ״긲CI;=vs\nx8_jNL*N%Z ݳxM(Ou~7߳L68a hٺ]<1%]w ,7gysMG/E֥w3E|MG69?jY~\m _cW:&9ׅ1Dy_x`vCπnǵQ0Enڨ-*F "^c2xHRsR¹qX3PD&;WOMˈ߬)>mK{yf5x_ya Pl$#a yfhB BWkYqj r d$*C>rsj$' j \ó ?-0f ޡ';I:OS۰2\Ёluv^!D?w0[JWsg1 cgϖi~C:HCt(sZֹJOgg} #sS0ȿGc D9`)ߓ YȅWsKT;˜,vq(K3z?u6Hju34nȆ(BB#k#`rhyBo鐟0G!L'[Y̆%b@?BeH'鰞s®{4`4vU|?T J1&TGiYQNTZj(>AHL׏sGFz{Up^K!R=.`36 .kIo,Iּ۬%`y2rM@iN WV"rl" ܤ­=̝E|"p-0[owCU®ts-$Yp\FC4=MB:3}IcD~4'Tg*FÙ^>|H}2Jv39ZtdliO+Cm22aᝬ(#3Bl"R>2]j6 qr,VYUگB蓏*6;1Գ |Io nb2^@XJa~E̔zr<{ҿ4fF+ uMOntWdJ"1Im9"iinQ^5^Qޅ ,OrjY8J7pWI]ueDDo]٫)A{t+46EĸvnH*T_*#@j-˹28ɷƪsj `4nDϛ) 2߼OmJe_JKA- _JQ2v^{dRi_FJutԼ)"q\=-:X$  Ҋ5Dݚl`&QUy`v_0JRu̹kkjˬ!q/V[Q˜&1=K:XUyXtLpG–WXanh:rܝ045化%ىM9{CgfbU讕M.7*TssfN-eԻfI/UCm0+sކLYT| K!2qEfGG#bK459w+nl*kR|Rh~)Z9m-5L.+ ʊk"_]tT֔IN+Fc(]R[!V+=a eefB=U "ZwPͺx nh7U\իpHdil[_O//­{Z=/g[gѝVj?Fa8E},+E1T``v\89O{ȯdtZpYD$;щhY#n--u3Y q<VQ* ꛗmIπ9Vջm_ ނX&)]ݜ.zzz [vj]ZlT']Ɲ2 !y٦mDDgh22S;pĒ r0^psJJ=iA-x|#8ve͖̜Ym^#Ql*=4ó8<ӡlBKmCH%:2 4svuNQSTNqU"^rl2_۟ky9yG[(*MӚ~D:6غRIFwgsQJ0gي&ܳccz/K%~cLe$L9ķS[v;4*I',5M8 A+%j@o\3W|n6u@w=Sj^*Wa%m jq2uE6Uhq]APi @\|^>17&A`XPU?Ya0"O.ROݯshېa]m @1gPq>MˊtyK%F7$L>2{ldI_uL̬F(0#(f;9-L0Đ4! 7EA:fFPiN<=N8:.)ȋ;0j~=7׶^h3J۩2/ZV yPJȓb*L9I(TG!g!d.uV("z%n&LԜ_&GOkk쒗A)+jlvuZWk(\Y!˜MuiGx0HAmUkH%3]Me$3Pr+k ԇ$O2JԸ9(I2ٱ mf 32rP zn7qPe;W)ЩHMǕxc= z\%IH4۞D,>w"Z»^ cM=z~Jme3sS;Y`d3K Mv*oiWX46~CHsqTb-S=nm~%mJz2\<-XabfHgG/ d ,0TIzIn'v\Wr:S#($W-3s2dwک%x]^KխJl/'8&Bp`.PƢR-9H$zҟ2}+%6ۅhb~w&9RGx6iN}]D׳YU8}F e/\x )4%e+g[l^0fTB?ģJ&+/XܳbmZzzc)Dʤ_;6fUX[Yd u;ﭯOF+G\I]y]Vb;>h;ʢO18ܯ"KP+=,"űJ2-lEԧ[TrXmeG-lUb!{÷^нȟ- +$]Wbr|/ g>߶H3nGΆ*}~6>cf$>? , &j?7agC bwby\ l4hjA13epwH*0Kf21mI2݈prÏkʅX7iU")4`2Ou|UN'yYh=ȵl6瓖L) [f)S+€ѵVtX}hsE3p?˽jZ "עf&Ẍ́gYlH[LWwT "u,OB|L! ;&᧨ lq%l"l:W?B5H*cstzMm91Л@r]5AXMu_\)b<ɩ J63q~K0ʋ;TQk Ywooڼ &? ^~` vYn0gyuKzƺПɌgIL?gz6Y=/jy OVf~R x5-?l c캙_]`Ս8gE9dޠy݇P`dv?q%Wߤ9"arzqpwv.@ěYfUT4lj! `!}z~Gس G^P:Nq\ups3 _p= j0pHAxz Cs :uf0QCX1dXV)eTdL U= WF*ՇeAFEFخuT^]tRp % 6'v/}{obZrRh|/)>)ݪ0:(}'=_EG=}R1=g K@U̿^9YRК K%ԅ!]I(+*%P+_r+&:t,7K^UP8U#VΔj@` QY/\/J{48]YMN:zg5?hN)_׶5SUw~GECE{>OBxRmĢ˔ <뒇Hw kU IAJԫh@Ygx,w1T"Ia]},5pz+x^LYɑS d6ͥ'޶דWnk[!`:~Mn9XT v䦑E Sp TXa0D1aQdb(\?u@5nSwI/ ".28'|+,.c'*\JZ ' =Y:>9"|+?M fJ,q,^QoKӲ@ﻦT #"xh0( ~ IDPȲL!ÆQ⹮( PR=%IMv҃Q%17ڌ\dާtC3<AH->UU6~-{v6.s2Q _M$#A3tx >:P?5#|ia 6iHu]B5Hxc*%C8[(&3 ZS$s$Uxԩe~g;+$(+ߞs%iP"RDû!B!kB F@%Obkw)c'Ub4nρWi_W=JIZM9$ݖQ3X IL͞f_Z~B;j6&en>E$:~pd샚tQT~́يHjv &5QVg,Hc=[Ҕ[T80i[GlThʫ먯+Qa9#ŇQ$oVlŘۉ>?GD}U Iz@vv@f܈A\"G85<s[~!X f8rSFN¢& GWWh1 l'掠p,6 T˭gZ;vŚ"$FlGl+Rt`Ry?Rj؄ hݹӒ?!v <#>v{+D9jޟTP7/Ɖ`l1Hmc"W&r'[O+!{CDu4S&O"7v0)z&lm)=sM }=?Ʃg'('<DP7Lݥh| 6=v 'ת׾wu/mZY>!i l׫E.%):r,HGřʍyj?a]չKEg'zC_8`?ۧqe:ms]";k6~yX/}* X!>i10RPuLʻg^>WߺKc }1u5vNJY M'K,z{D_ gOPD(.c4?tSz5օ &aDuLGe٥]!MI_ҟ&SL'jr]+V]!CuWo|f.@9>Ƭ$/гYeCj9$0^){ z.ɶгs$mRDn~xEö}ڶv=K !\Q(cfu^A (\c9WpĻ~n禳{OI5(gh5<,=Rts:c'Щt#t[R+N 7n4쵻a*UGw:x,B;-f**;,Fɧ~1ŸzgKܿ Oޘ52BD 1st9cԂLDoO|NI<~"giN>|.;_~F)Sz@W=-$5?H!Kl؇*n/DzPIyʯWafjUWkdH'f'Cmj IO&cŊܘ] :(SH8{SX8ЌFȆS*GK0 $'(PJ O(|oev!qA{d쏯1Y .LЍCob,9p@ubnk}:vuX7^aJ+; ATkC@PrXާ|i3{m_η \M~.!N5aTiZh,B 8"9uF@r25C>U}v}d!7[u>]_;'Ӂh@'~l#9P31(,Ϥ(dH_D=agl$i3T~wD͏/SuB՗5+Oɦ sz`U5 *TF! `?",QQEn|X_5qeI?{~Em|M7x}~8L!Ӧ `6{ ,m0cx+uH.A햂}DC7\ody''j\\<7o7kfȺ0 3E߻A2"_PvY 떺X+.Bm3UꃗlKՔK.~d'&^nZB5sJU՜&{|@`HStULۃo/Q?8=ޞZ5M*5+c%𱈢@ !%P4Pc?-m ! M?l"&F:(?V,w9u apH@gJY@:2taM<`s(nj{vq>GfPn! 98eDˉ zH}H1=w]E,b!Vu~Z ,e~o<0f^y(H34 Ui]Sns>WbCqv:փ^P`YSh(lmg#ۜ۹|("[qO,Rc0ja`ȢA%v]O-ms M0[sߎ83+pDL@Q!> /?hFC푁$Z/\~lMBD;T!i&z;gCHs=>]n)S-.jw# yt'u.˶m+Leo@P\ ,t.Gvrxo>eUQ |m8BG~=N5 d~V g?( PNf3 9~T'!Zwp'@$g0s-`+i{r]8ʼn7kia t $Ӑb#=>S#>vQQ*FV6-%}٧h/(BG~5n6p5CIS1b@#\-^ƱJ5a^~{]CX2DwMClȇ9=z@7bCh牘Cދ-zȈ↞p/;CC&@!$Ԋ0HMqB0H AoQi,^(VZ`$? iI0H1W[⿥2,H5sWswC49]?Nd[QeFDZک rٖ-ΈZR>BGH6\kw HJL@ߝ)xNQ;.{C#/8sBAg,v~+B7lǭ~>=RC;Lya&5KEJ~v](hGz{B,2\K2c &U(ı 1uև.!e\$kb@i͙93X[~4e]X Th&rDے͐e(*rWmrҲV[_DƟȸ$ $0'Z+ Y+1 2)+u.X"^C%Pvu{9ÔYqIRȧ`!Ǵ&D-0%RtϤ 5<3#%C$Q%g5Qksu5u x)f)DdxCYžLd/q\ ;{^ZI!>'}ǣbY]@\xG/*|#Q+(h > N4ai>Qv((ud7y)Au-`d)*Al%BXwp+~ֽ4+ P_Rd4b("Q˵6e `-빶J)Y=^Li "!Tz㰴r߹.#i^iKp'#w_XJ+قO-Y6䂗qIFT&1&Fm<LK%eWi%sa O3 ׅ#u=_>+9bcڒ h YaH$Nxj[ NY*rL^ݼI&S/}Vڮ#hciwn1M=e6 Ђr[v]]u۔-wv>p%+|rϷ0y{v %Mlҁz!iR%@AZ6fKix9 #k̷SiQ}4q+ڹJFu)jG ͵?5T~l͉vFeYAR& 31uϔ~_xgÜn@(hW~ >Rb,F3-A U$0"),33júhb mxLQ[6Zn6UTT< )_1Z7ϛdlXR!1} . ,K58IDmY ^*fu+݋pJ/ DO>\q˾E". ,Rឡ> $CNTb"vEPIAG fOHZ0]V` HfewTuє-ɇhM*LԮ~APB2 Yqy@7*;kzu7ٸpP@hc wvnt~Fi$Hi 7i~@r5',LwKU؟e2le'ffuyʐœ=:p4yf/=GSPc"|^z!p/;EhC)7ų!1tW~2dct<Ӟ6pN`1pm~ (R8yK =BɉGi+5?Ij]qfbX=`ҫ{pg}O'yy:yYWQt Ȓ-e3{jΘSaj0`dX5s jCA@FpR?f-i`뷂 P!Hz^ǘ ?p-(ћnUVְ-4aK4vL\b"1,R&ԓBKNt-uZgיjZ,Zψzw} ~i`sIZ$|U Sm&,DFt"WF"sk]1@{9 l˕5Nɕu!4PFx[cޗR4$] bVpGZ~X*{VVP8O2Oޕ-<#SR-dd0ψS )EłoQѱW&X9U&~x*0P+;!xW&f!gʑaafcuzr9;[[=· +.ivPy2w+pcr쌞-pK4:%_u(Y3I>mwk@`દN[:.rœ|d v4H z zH,=o>PElc" O@Qpd:[hyg0`lȼ YT]ͭofnCt;iv|mO$u ?Z@ X ..P/{iqTg-!a^7d&cT_eĐñzˎ1 ڦrHnw1t{lMpq̞N)Zsś%d*-˓Ӕtʽ\>+u$wVE!aLޫgGx#0+u7+i+[^v/WUb-.$$n^m }JNo-GVzKU nN8mn-̅F?ƆvK5Ls,wVpd 3ch@t+%Q89˝m֥_1|={{Pcu e9a[ֶwD]V1( Wv㿦W17栋 AxF[h-xrgy5FOUQkJA%OàKJPoѺڈRI8 [ؾ"1MT4% (B+-6gؿ"ɝR_Z {<| /J$-i-=L jz"MNE~NAhFS,ӽ%."⃉D Qd~mNZ_ ͠1B&5s5ixuǂ]$H$VZ,..^qo+ܜ@FɊ# #\{Q߉nL1!<éD# Bg'Bx4fhR~o5a iV#vK/]x.FK^.R=JPnF1:(>Fw| Jۄ?Uo*:(0701{%$kz!Rgt!"/? YPޘ s;v ѿݥF-^YOS4 &Jn\">?U)`r!~Xq6ZV2:fen%ưާ};x޶y[W)'cL֭Q6|F!k4e>c8 !N8`(zGek@.ℴOcfΓ9q<Jۨ .6l -' m"#J1ErrftAt0ie,0ߗ.9S\C^sJ ,MWA R#5u!qSHZ@KXk'XaZ7,@Farm7zOp{N^vLEH(=_RLpbL]JEXQ_Tù8 e |{8>t\&%@.-'k`XHzB$$~}^KE\9Ҁ+vTmMtn{s v'rVSd-#ٮ\EEC}FjؐƜ3-=^[=cRu[NES + Cijm.͚LK=G$lB8q)]X$\/כ r pq443G '"g` .1.0N6Fib?>DIOD|/: .  RC]T1j(̰" /D7fyN旗ԧzL 'Uj܇DZX!+jYn=iy͝H_G@г Wqy5[ [XHcPhÅY>SNAwMXG$&j*D ((=G6%2$뚸V0~}9a[ c`. է]U0R6u־>>7Ad$_OQjSiIxQܑ7Ti7B,Ks/CؓD$&s{+ȞMMZe`Sgٺ[8/<%HAt9zz>1m,&;F,e닽+ޅ9|4quƫr;~15hܛ_kg|*G[oz7BSsFG}P̀yIm*fk;yVد1o48OIl: Z߆d~&uF\7]NNf&4YΝQѺn )DjeY uc =! 2A#Ji,Z4jSA.mvg}Jd7<&M;hf@W=˪J+拄 ˛c =лxlT)2^pu1~'Mn'՛I-Vl<z\ײ9x C\t+-2m3NsM9Ӹ]Ç:fypFFJ-RK,B<%1E}J3E@@r,7=)o U&+BkKPF=]WUPQo~t$H-cܔwExdo[;L\-ob VRTP^cZ J&uh7 M?G2C= W~m݅]1 qsj)M=:zcӭpl,BS5W$&۬M}133LFƹFK$wohqWjjMͿFJw;EFTIyEDvT5jWQ3b{LXZjoq,-.4W=6=s//1%{4B@e!$924_?(tzûO3(=9+??ԝ,ƋUV|%JrJH)&')`bW||aA ڲ+OMa*:,sT8K|iFZD-*s_D!3P]иV}2ǶU>'>&@#C%iZ<'rNAkXƝF݉$P%28VJ#,&Tq ա}f3!/ǞF}0$= z?ELR( D@D I3Qr9\ S.\$b _p(]&@җ?)4?A(!+=ɉ$@i7/#8Yq\ bKs6Bg5`^"ZJ[ű3.?OK`Pt Culک@F{(ԧ{.B&pP5 ÒH6eUjW09Nlj6L4Cָ0l}& Qp֡G MG^`o@n(um;BOAISVy]%!$Lr =[sWQ fNJb߂`wB]up}IbZt΍8-Ƒ9oB>Bi݉oLU_-- eT`'!tل!h2d$`^ 4zJrg{ iX9Wd [KB™~,4Ig0 j@E A$m􊽌G%Ny#arl8&XuJr7OJ؛BсopVP2@lqmپ*fg KetZ)V\FIQ xJ_}k]XOEyԹc.ۆ7i욠D9m?*FM#H\*=J<2mf_aTjL8|OD5DuSۚ*NTalA@`獥՗4+| {x=s*a]NĬUa'$LJ9 ׽L[NsDύpFN#zT"ޯ@P^At椵1: ZE]iEa76<XB I"(mЮvBQSJ-W~X,ՙ`H,o_94bURwt`%Is?}|AtLcHw/ƨu@= "uC`?fЂJR 99xN'I8&^5<kR8)Yfm+:5/tf[^-$W֧[(kwv%vzqq7@[gx`Cq#&۫J$)9ps1ST:b0 &s!JxZ ^! j<CV9$d+ a/ bsrGi Xք#դF35q*nAnݓ1u3i\ yj* S4BAp恀CJ "ޭc0Jp%LĠ&{D4VG9 ebSɍ2TbjfE4Q2+YföaR6U=,0KV`fYWE"rW7-h?T@\m2I*dq'a5_PX$ZodԛkXgKmTb;:EUZ/!q V%Iʻ +BM*)P_ߠ#+qUx@( 밒0p~Qȵ 67GF36x%3()ЪL;f_<X@GK&'@$ؔ@7@~$Me`*CS{G?7h IAr?&Z2% 6.ޟ9%J9+Ⲩht:Xѳ}'헱dgfϱ!aVm@f;l_;܄}.8cV9|wrqW0 )ЭjIҸBqvܷ*XMX疇 ǺH :OUSA~s+1YoL`z NƋL10KN%;AZk/cm[},K2zg*?<]P2ƍڑ"bެ )b`_l9=EL>k  QWSv \`7.u|A{qe rԗVZDvVcϕHX6er궣HVΔi],"([҄{"i!?`rE| \ 4`d˛(02ѱbO9=,՟F5.`ߵI%+|'PyC ^i|[,Jǐ *U &n^R{fc$tJΟB!{T!7aYlTMhX6Nܫa $7roM}~-?K1G^Tzq3η5I݌bKP4OJ;G1z]p؋jP^}7{]_`sA{_zfw Os`6p&8f! ""0mR'fb i9-qQ_-cb9?jq,*Eг:H"Wh5ćChVBKhg 4(ф~iHbWёj8 - [d-4zC_344]xjd>4RrŽiPd<`bwhܐܕ5 $HBS:@I$b~D:#&h63=%9VSZ%uࣣy[+.M%ğ#RWg/tK!! (% HY&@5>'eUD2XLPiu% `=5v_2Ҏyjo"l2&Gk۠N;uTWjj7 7Cowߟ0+=t3H.̐ Z\Pި^LW.@.3}rW &nПmi~œeʁ4$o~ԡ+yz{]jD޽ݻԼNUr's~b+`ً_{ҥc%mQ:LhSz'dD #a*%[x0,^[Am6r&e[W7O˩N]+Sjm V mWxSu`箽ۈd.fp!x[TP,Z;; mj!ih.[LJaPs{ɼ- ebffkńV`ApMޝ ^@a= !DwCU2{V|bE?h! Hۉi]`ye)g!}_e̷}^;{}NҺ.^QsGv#ԔJҖJ6$[#T7oE!]NTIYD9A3*BDySܨ po*./{׆en{z4{ػmA_ELJšg5؜I$z;< $`/It~~ئqA,8ufHvQCzG {3kHGyXr1[1w'k-%jy[RҺKu1ʂ.t^ K529nҾ Estt'=S:!i]77G r_|,ދ8G<I^fWcg_y6>쏛8H{D1%)e,%xvOF]d|Q@( ALzA#I9͛ \PEn CE5ۛNAbsh)SKt{1Hd2"4y@ B"]7{} N?Qڼ96lRt y<(y$ŒDӂ9CV̈$| ,2.- ە S$P)γl{rA ( g 1eİxƣy%x(*e*:YI~{Q垯֣W֣$޻1J 9c߾PWvDwcz@x|v|\"79,o+^@z 1K y|=G,g!pgPeL%i"ظcx%V5F~:b ԡ$UICyBl5LiD%ԏJo?s[ `7 n Ė_EQU̒E;YєsyHQ &e%[ԍ8\i=LVaa͆߳|Wt#6~gdM0Gĭ`0O7^";;(%bT[EfmCUjcAr`gu|tDPo鑥`Yfb~+E#hm!xhq5rzDF >_x^/uW P)`p. ųOiNRlX*g[$jfw}_0,*>D.xH*)\s/7=3T&a!M3JHAܧT}~iyТvQtpF]t\`[SJ/(pf^"x\3|S| \pu0Qm1\ʲ`,d;KH]RI$,u,ЋeOlsX}Mj)Y}QMQAXU]yX\L7VL ֒i(ؒ_N~~n~UU+|Оh%!plpBm9wŘzTFehjܳgA$cl4 bpL/gO`=?dl&fwoJq_/.U;,rиU.[!W|pA;H/y1Zll%В2/Wdm$ Qہ'NYZ14UraXᳪ{"}pq{i ՐKAx5,l tY/6VA&Pwt\ %@,$\ -4˲OpVO1-Lp!^$glR%{yU9@VbC&HA]j5RƋ~a۵)>y״s[JmIk/ϷCoKEUۦ԰ hAZ(1bI0) D/_ QXjWX9e;-_eB\M,{: $6,h05B:>E%F44 4PR 0a-t^n}k:ɣXǛsa3RdG8[>UCt4LxVH3P$VAB\;=ɬdI? !:r2+J[%UE*T9B9*_&w ޓ-F\+x=yFIF>EP707:ųO? uOJqr;t_9v|=IN}؈ Q}Oze3g%@؁}#^{L5Y ]sY2־it~B4 ⑔ոuuX%BDEU`CTnVjl_vޚ QoEaU+aԷ 2ҭG4Lu\/)P.CcS ŅFRTY̒|M (rP'\nr$Lpƹ{`SoȰtɽn}5IMmR Tg)F|S8Jl 0S{7iQPF9̈́5lĢAjXV蒨5A&aʻt[Pda[RLf`=fXCG*pFqCpLE.q"jwHXFY(} (4j'LD'VHc z+ʏȩWf1 i!9q]ZO"(0#kGȫdvq 3eͷU2lݟS)gDY6ABt:lӦu | @(?>AΣ*1+$3 hL(~CR8ƶE;҉1;r̖QGPӥ:/02O{xw:$6-eYor͡h%O\^K[atz*͝KǨUu3ܮ;׽H:l[jFbR73 AA|Xd"KRSJ1> ^? cE*l/y 0⎾5 MV9"Xe-]^O`x?}:szQR6r ln"x@J"R/y*#wDVEpw)m䘂A?BLHcL+0 jNcTNI eU+"҃ʣY_g2?S5܃3ou*K-UmH).%qdc팵 K(BŝUA7]1z3-3Dbc"\fOܟ?UZiODhyj5=b+0ze0gY؆]ϒ/ qJUFHx|aQ\00lAF!_k)sGZinV>[ M)zM?-=1rE0]/j W+̈^kuxGK!7vE !1 tVۊqg R0HGɘv *Ě qón1PE?Y< 62 X:p&jr%¦qaeZD_> 7zO7HkwCnutl AO8BVׅD6s| YH6$}_X.uXԫQ%17%UJGV7ӵ}SOf%@"ģMgnP\gtpWk5uUؘYYd@d@gn K^dv_zUo:׀-٠O"зpitIuT ҴӺ3s!U:'7gWN  B;5P1cZLX U߫"Vaƍ7zg.hB[{9ț /BzL'b![woagd jY=NSg7 !(&SȔBijQ 3eO&Gv~L8ۻ˛?1<SvEZhH&(`T |/({"a#s;.uMPᒋ٢~=fs8n-NO.<(LXZ!gXjPS4E$Ҡ@ JITv¯pA'<~.Zp|Ψ>;<76P\T Ne7q1]rDZ@%zG"W;/9J5z {Hv;bPcNQh L@A.kh:Wܤ2ɮk29qXz4Vzv?ҋ\0z + )G1ꔡ9`Z bY~zUcn=X`ݺ0b@ 7y(ERR:}fI:n<^%ֺdzH{#wY0}bydS3TK]VvK3~p|'%;MEΒ E&Lw_1SjK`t:+hۗ9j!pK-A34$ /7}ytR sz85gQ`iT oc)f/S~QJc0R0@ƒ @[:|dN450>X~h!MRʳӮ+(ǧBYE! $L0 0 <ô++0HNT"i{Kf_eݤ.ALZ6%Dsk#="xp꯴jeۜ#KeJ8T'-+ȩT4h@BT)xz/YlPch"rD2_/ W6Jq#CvY0`7ZYeZWԑQ/Vw6+FP `5¼a}En?oS#As0~>3|tGo-( &Ob4|-鶧BMUk/pjG,DUմ*2i<޸η*#dЧVBzf[ѢWe/);.O]?]hqYslwY: Mc,1T (C_boߑ>?P/9K^U hhAIt$aʴz3٤=?sV_ ^%U3w"ÎCF;p34u@R ndVM+\S>b$mHhFKCǫπܠ;&Nd^[a)Y#4ŒZ*EY#X9, 7fKa&;@mMXvzҰA,$ s{zBi$·\&~+`S:>0 THͽBdHbv=g2~Fг=f@86Z&TdW LnVoߺlՓe[0 XIiv*jʤj%D#`k'#m6I`BA6P/HG;}]k/hm[7y`V b"4."|*:5TD!YpXlܷqv5p6]{' 1ΰA)ah\ BDIJ%}V&@T1Hm8>"a/_eU.S+"%N"*&[0 o k?m>we~oG8H<$&dڞ+ظ\$Ighbzenm‹cӾ)%m%7$1bGόrVmcqVyhm 9 N<_[ON\]7K(SYQlb5tBE>cQ֥;ADïl%LBUFxD qϓKvI'2z~&5%0WAna4<~MZÑײ.ИgwyQ6mHI$Y;IΈ{/MRiPL\8A1g$`9PDB (cL A%!d-f.DIrUح,[:|ߵ$S:ےR͇C`D^("C~oW4.וo!Tr9d"h-@:T6DY!D j i&H`@RH} :ʤEZjaۯYn\;HUcOVJyjm,#1]D1sa"8C'_v$\w{;dv;,D ZQ ι0!Ò1FQϕݿ }x {kEQY4+yA)P 7"7Gt.KALN(ʔ/^+??7g_~}E2g[LrLׯ?gƝ9! u76R8zख़qLK\+o!g. ԮuZv1sγ"ݟzղ,@PAxFݿp.ltaŇg$KR]f31[ tz-b"wPQxǘ=Xq\7.VRu";^D&h@X:*K&[>Oe?cB_ԫCiCWh ;F˓s͡k"- , FbL@yFf W mlB~ՇơH, W/EdRI"Iei!hQ- FzGT[޵KMVQղ̌p%оzkĪMf$xIObEO+'Vs=+wxq, gJ-.Eҋ A Gg;G6 {Zv͗sKCc\dc,0N)*w 1U^aBs #K=)$K(E2!⦪Q Pt=lyUHi a|jFPUʋ ?.1/ 75f( GÎe-4XmCCzg)=[8^&\ږ4O\hx6-C:X pB<ɪ5#~oeup15"GTK TB:"̖fh'lT26g yX@a(T`'!8?YKܵaWجt}i!Rg?n W`:3Vi]PW#41R>VtXő z!bbO-bd^;&,>wܾ!>&[_f *Aw,\y$ Jx:j튰)35Ř$qS /D:@Qo nK"fP QE_ "K% PN\\SZGYݶk'/;EZ՞;FdUV:P..XoU~gupކ`l$޷ FIx;-7 ffY>Oam%s-GmE bľmhi'r쪪͏nɃҳN .?\ NSrϮ2G"* v59r 1z5ǵ*5ɧԽE / ׷D&&W^Q"%N x0Rr3-CBJܲO6 az&BL˨"P48N?WO+_Kfj6 "?i.1J+DVM;:&{MVe>k:%[U@YzqG OiV(0QaٜB K -Эn-~/&s6BOjArgV(ǝ-)`]p9ÌnmLM5.3)$Иy$I9H9oqǣ&D96iӭK+`o(f,UL`NSe%OX꽞U6 ~.MlC"0"^MtQ[ɨ}Ef3=Sr6髁?u|WqR1kIRIdt0J2-"- */KVwo! '%X8Wh'yМGiC}BդGȭټIE;5M̸_噰܆C[++Bxeeg萓.v^cۃ̥<Ш 2kIf(Gj\SƜqK'o9 @4*QZ@4JLD[FgN6˻>BTA7nKšGUW?:64]+s֢MJw~n//tI.!?>‡n˔NDIG tN$H~1/2#;-%?%qX8UZ6ey Ţ 3A0f H`]* QL׸֊^^ƻ &Pֲ-|Ij~N.=y|9 blP IF(UՄB"t_%:j .^t2QLzg{A7"I?9 0V` 9Ʀ架/jk@:ZplQ9$8ˊ Qu1R3d.F=;*&k4>#rX?{ |NeڨeT1MzѾ4bE?ԫ֑e=\95yߧ$!\8k;thn'1GܒC:fo3% |41NLT)i_n; tuA B*PRE6kO `!خri^TlSrc] [g&`Vi0 SӃｑyw+ P\J(pHGyrlBǾ&?P=_^ɇ@ǫG>MFF!䖼Y$fh&hN|^-#,K튶&V,n<;^ժs"ȨE:G45cnUL6mz6&)<_PCRpkdlAv_6!u7e,i򿿛#N=H_pMZŦ|y4(ލOPy—S& g^ NDΦʣ*v l.tt tݮoQ½W;n ㇁( " .QXGT\:& }e"y&|ӳVZ#b8,M$qa`߯zIteB}=Xo_* &R,I Fn]1L7iY>Kk|C|cПoCFFzOe?+8y86m>sc@yHh-HFemZ0@S0pdf'|i#2F,[7?ڇ o0x;)OH0PЦƶDp3q7M0ށMAi"f5UZm"ꪲbY3 "q)4x@y!JSZܗֽ_2wBxt$D%Gm5IlGM0[-+ѿ4RCV $9lJ&A qn ښupuy;$ܸ$$=s޶ ^lj,HAn[]ظܲ$EsO垈cA7ӱ4Q#{ K5oϛuy-5Z ==q=F7}l֯&$p D@1']E A PSy4ި*Mz doylЗ&k橙 @t7Pxft;P@ Kr` nLw#6OX5PO͵Rl[)&9짭oYzAƽEw7brx$!f -g4 Pɺ1( Bij?YK`j$n=gTGSBbf0r[.srxYU) !ÂDb"~[#PRcٹ+,]1{=#Ϊ& NկDBAȊv^:>G1ͫB8tXv9#pkZv /I@B+p#`.8| z vI}q_Pы9ilu4@f sk]}F9u#ONWơrp&K$cρ9U|ӣSFyM!&a; JH׎VyEF$DB|y[C+6 .RC. QuPH"1\SNQ69XRh笲0N= Iea͎KZԲR.TL* `%),:LLfC0$0`$&T_|I|o !. ~#y~l"dCNWP@ rI4 BRr@E~R 997視\cٿm ')>H TUƲ AՙoLǑ C|%q\ ,hN!!$m*])RW)52mXK Z^T\(п9%jE>mkw.XWi]> Wt\jy[^m%"9]|pBpz>sLL/12N[@ CbEIݍ#b=C AORH1 0#]`bBԷ p_O/R{@DPŜ$Io{EPG cFCHH6^џ&/Ӿ `f$  oa4(+;'VТdt\㤙7}_ZޠVFV]}6F_vQ`cќk찘lg ;Fpf,m鮶|tI=NxvKi?ͱ_ki`8LĜA$3oe 9k?ݤ+nԜ)~w5ǓzЊbA`dǃ}%`Z"vr |b~S~4O9dԊJJ @0AFM9ݚ~58XUhYl> ZL A)0o%#h0Wz_ #-i[bWS!)](bd\T  MpLtZ ]=<ȯt  l?,0CHAˎP|<<Γހ[ٜ +]2M `gS ?b6vZD #~EPqi=^/Ѳs}&ݝtp&'qG'P6g."}SwD| ʶ8@fr\v/CfSGO Hyi{Sp^U9~J~}C~NCϯCXbD wɗh!aʠ@.> A@UR$ aG+j[_=,v=空}1 U)bvbM`cq(_#FE\zਐ|b_ops;CC3O<2Na%5c9K@tm0%C1;=83:P.0,!u?2æs`Li3Fmf=i8!!'*=)ڜS;v؉L]q1}3r]d7M1;UΡՒ $CX.aP̂iRiI{;ցK̮ȓIJyV׹K`_HT W7p@V_շ6v cWWqܭ$7&a*oRBMH@d$MkjT$GLJ~ԻOP}&'E1q.mفLck̿ut+êcKla˶5'8$\`@R[Ez*>1+m} tk=mKuj+:tx &vC " 0ՠJ ?)Mm 2NxRӟcN9\ht[Ch_P3~w{wsJBo9l ~c$ٯf4jia - y˜@( 'qV~櫬=376AzFoZ˕CZڷ짋oBFQ7st1-KrMXLq_iDmJHY*R{UJD[/=V"Q*VB'#+p{2XUx;;6RB#4$Z`J_9/[X /n!ef @b{,C}.^=G$twgdv3s%BрR tl6r ,((l@pamWZS mb1#vڔC{/To7Y.શ nZUoP ~Dc`B=J&$ a'i韡by=s+Z^ٲTd ڰ /آJq~OeN&}IIh?ENA?705<ӟ.^WO45M D!?H^79!͛С'LD,n|Z(0#BI!M^ v|# '~r8?(灘z/7Z d`VikGy&mԓe 7+T?FIaYSBc*E"7 yK$t@Aga^& g{O?gM3V/p_nԼl)2JG~ƒxxGQ<|:oKj@M*y+*W5;hmb;g.hXOU d:Dƛ"|MP(X1f5-eUZvFZ+kV/-#+t6~q5 J-8S EVQ>jn_{\'+{ys?tCt9@;y6n Oܲ__=ٓ$1bs ?Ob?)5NM :6y#p>wocw?HY!'F@~A.B3um3Ik2svItV_Vol<n'9ܾG*_vXK8r/7H5J<e%D&#,.pҏDrK<")ʏYDzJ-?w?h#'?rVʷ}ͦ_R ~i@L I #Tp@7՞?ԇh f0P7YC+􂃓@aUc{ .ReĐEBSTfjZtkpHZ랪+LpVD%jwr ͽ{Zh?~cLa'?&}pR@ht˕~iLPvǽ+o>%UkN5p$ıH!NS9vB=˃Ipj}*,Xs +gr9.jF#3MUOO^h(+jkn$(X;5C{<_W pJS M`@s E!l7|g;<z|!ga׬T"J.)H3f̣tldTD[{\SL6 m|]j髚ʥB $[`kX_ C_$La+V(:6:* ٠N2xg94fsT]EZLlj~Ils!#+O>.K$L ;mfk*}[r,5dQ,KZFŔf+KW.Y`#Ш<@󔅗@4#M޷$0/P՜8`(QoW$17 O~ci<ΗNՕ! em`ZG-Qf¾Z̽9Iebܨ-# 力H*J.Ȍ}ƣdSCLE&̙5R!UZH7+ިΡJSFw}!?-ػm[g?YnYS 0JG06 Wks"T oAUë=\4bG?v|\`y3ȰzSwӳh2"”Њ WKu08t(HfѭAěH~F˘#b:2i@T:4u!z7{_iXb;Qݰy_l %f'()RDg$t~(}TZЬ5T?\"%c'ML!?ԎWsXjЖ,%RMED@@&ywQ R K&QM'~4C?g`߽dY֫ %{RW=*g|jbmIWe6,t=_;޿|-&vv]QNkm%~,tߣYA=V: y^9NM7?lfٖ?eY$ #s~TPz_ G̔KgŖ4˱I|Q+#Njh+EcK _|w}bov!eVsGA5JQ#6)85S*-,XN`a")~sT6^D$OJ̻=3.΁//]kv<ˊ(QmبIms1~bo2y[> N{]44>s56.Zg\`eB& Dk^MG"L\S!ÑS)òY:uJeSŤQ!eMrޛb_="Y*7B'*ĐYJ^MzsRunMtR>5UU"\$ t;QF"8z8&*ǜ0F pHJ%XW$ǥlj]7?>#J̬):hj#-~glfH Lz(D2J2ܡy[bV3n0u$}OZjdǙJj. tm$ėb E3T;)[^湤+Hyj% j <,eRIYZS.Un6Ҟ{I;רZn!2i e < K ][,ZنR,onkںңc}.<ۥunQŲ[5rk;w̼\[2SdhE͎X6FD4T`\҈Dΰ ÅdgqN67<&J" )jk\1Lo_' Q-C}a^]@HQF |k-SloW&x@]YB7{ y25e ]Foʇm3!8_'6vt<Wm5) Mbb@\<8s fn [ȇ)/^A RAKI!;R2C,Tf>^2Mۊo/!,{S\Yo_ҢѰ/7Y(!l͈l0\GWڮn|Z Όe?LX Xs Tmۊ6FsH BF8=Q  N{G:Ӳ, o=Qq2^I7+OQ=yY4cOkUO*d3:7V*'Z3¢ea62BN0J#,"f]vHʤDq,V<0}JjۘYՎ?Y%ӛ^;%m,Q7/ͮq=i=edn3:E9).ODN[[jݡ,(CZX70!b)%H`P"f>x9Ak0zӜaYO$yX.dt0H"[ 3>dHsZhgYrd:.ݲm%K5() A v"DbPD;BL8UM?cO, v S-  d9̦)Rv:n )[cջ_&I/:vr u)! *-Z\3=Ov{N))'ǖV%$P!YKR))"L_CG")rvhQe"xkisB5٦367VRLdv;R " )NV޹7$DVkQ%=+ {j*6 S$$AmKw/!g,Ȕ' \+N©wAs[E@S(GH?j8׈(~TFV8&0ty `VLP^ ,ldlf2M>-Hkٳ΂{Uj!ABz%$afØŻ'I1Ċ͟|l;2s=A6BvN_myTI$( ;4dpޜw!i-e0|cjWm~\<;O oZ?V#@Kq4{,,taN!џrڗk C}16eiQb4(\2UH@HK Q9.ʕ[z <>k>oYg%~…[uU}w" RIt|OsfKk"͹T<|__ דxmd?;njZc7q=GǑ-!uSDK{I[Lܯ;>}#;=H@8#QϺj܈;I"eE7_]~ZK(k&*dN9_"]zb>{xS؈K:&LK~j$ˤYdD2ݰB"ոqj9XlyzLt:YC햼r40ӍOBxUN\) T}u[X_" #W֑>{F@U0l,eH4A3Ĭyor3߲$z w˫%bn\A|cT < D<0ylmk{׽>B{^,}'q\ A9.SD A<H.- &.f=␘vl¬zNf'cEKRW0[_D5C75Ёq: S?/W@* .|gb!SL.x84Y̺ Ԙ" GuGPe~&BAh< Cϡ/sEKCc.ou?~=!1R$w, b֚N B;Q0Y xmsmk0=W&gȱ7[ψ'8U+d'>PT6Sc#Aa9O/NB~ 2# H " va"@ 9 2^wZZ3Զ-B [owYNl}y>Cܰ.#lH 2a\&IgFvϑ]P5T*_}GZ&]Ag@ӥI,)CEWRIQ :Ae)8"3AD svRknַ byq7ݴU˴佱m8"ݾ,Td\dW4HubkesU{{da-ӺC_ _%4b8BL'VCK>%nvo6x/j:NZP;R=G|bD" Ds w5:΀*y:&ArGQ=1~v5-]nJ2Eqe/6 U8z֒٣=iW,&J6MU$LŐ.ekȧ"mUUVNJd;:5ڊQwov5\N-G֏W_=A9溻E?DMb]+"TdO*Zl K+`}ٜpEYU]}UP@ByO|7 [ *5:J "H9?\sToj{+FX2iDy SH0$ Ccs~;SPh%fWӡuuQ5j/i~{~ә`ӯvig$`$#-2I0R g_x3W-lTuɖ`Չd(׍.` ")\wnOt i/ϓH!v1&e"]ᬣwG :ݼF|mDD")$-Q 5lWU),q&sEa>-QȃAY^Xj^c)=@r%r0;3<tB"0R:NUUHr yHB_Ue6W&=lw_1\ ?\G$=v=/0ŰV]NtDH}qR"Q F7BEV+0rޱei<{ȼ@6ad,^*XQ^.W.mFPJMJio)uZl<Kw~7zGWDQ-  |srMD@@f` 6ܶ3/ l`2K}tOGkS[i2[@8yoɈ>:ԴKy|C=h]}EI=7,4e҄Zf  7A-7̈Zg "Cؠ&BuSLx0/2gG=noM~wtgkҩJ14ؘ] M{q(.L*:X!r^uvOa+\h,Y/Ŧ] ܤ>V_W>6j>KޜX綔Aqb|I1T6 XAs&bY讐iMvT+h dR++״43JJP $ٳS4`İ1|hKԷFtg|?%Bne^8!>Bw/JEw+Thzء|G3Ciz*ztœ\rJ2 PJ}$*}VwJQJ8 fh+X_HR]/0Ŝ[ d6A/BOyJPKËPϊ7ߊ`mB&5Mcd}[ZG(c's*[1-#!ćk?Ϟ@Tr,T\9:<^>N ·-CŸ36pnlui[& Ha+/{Vxۂ˜ ҵ+J2>v."[:`;__U]T?:W m'mM_Bռۑ1ק Jο~i>(i_V}mu)xdXcB]ـWI $BI^._^aK((Z Bp{)4m}o=?U:CT$Z2fRVPL펖!h8;74ݯ볖9چ}ĕ;ѱ+dUR}zLhNhJy_MN&rK6iUvԥCt`Ki^, IiA{CFG6qqR8cGN[ uVb|g{ʫFlf :HtzjFES>ŗbZ@l >3[Wzg+N0=IN}{D͹S'Ad{ YT+-JRV] ҼbUz&(_CVTDvM~{7Y~˪/}g"tX<i91u`-lX6z !E.kkQz} đYhuQNKƘqJ D_.7TȖa@U-1 t_frE3*@AaZޙZEmJCծ|Y NB,fuHk:ᕎIض[+C;.7Cᓇ1ȂFj.8eE M %U%c(<(=22[B>v1QupAZj]>Dc{y)ab~ةwsUL:eeQ_g"4rgE@ YMl7Pt{297|$c,%Q!/~0ukkI]]TO*E1 @p)XhIǯ %fE+SݎbH!5A$w H AS-Ȇ)1Rh |RFˤDi%r P%ً o7 aH5!_ DS5 ʺ('e^ Ç>QZBU€c iT8'l:6 v.قwdWX/l^F,)fĮI~ggLE61ֹ{y_\)>+ǫp3"v>~Wa- 7Voϰ1mEmN<U/P0dj^. P~Gw%"#KBS8r, U@[݊ G}h~;ЍN|}Yj_'fY@JvUr4qUjU[kn*?f@vcvkKГ"k 0S;ʔ<"#hCw¥+ˠåᭌ *"e=ZzZ,&}8bqI 1֊Ua~t¡+@3Wh0 a(:Ӹg]:lsYQRD'&P t*J%yHEd0,Wjq>E^Gқ2t:c$HLrg Z6N.ي4IBb̾w9oL"ךNN\Mbk{oa(f9?>tXxcEu&YkC k@Fj#MWi8$[F%;wޯnR޷=Mx]eWmbyL@.IiV4-[Ɩ4WiK] Ji9Ujɮ해`=1Prȍ̫\u4\jEE_mKb314J굂\R\ePOMT>U=<:e~HMk KTݙW NC`LrOimR*QpI-"ٳzhܞ [*Fy'ք^ǗD3Տiʻ߭3V+[WY:#.3BveQ]9i$BvS4?NʔlMҍ\OT՝Y?IcIE>͓Sk>TxK֡5(iԚD.ۻcLo lI ٬LR 9+Tx9F@jvA$}T@Xa&^v cPg>þ{'t'|P-16smthz bNDG2iy)E "P7D́O rP gsך0|J-{B߬(K!}.ct7`P*!S.my{s9d7OJwh2xdfnLvP)y69.%ڮMMW]._nm5=Q0 n%m9k錦UPhT#{^infu;Fw 'L}Jb"GL tN4(NE-tԽ4~ڹͱwTLqQ7W\ m`)"JP'n~m}bH]F<؁qqJE@ Rylr&"8^v[m PncYaBkW}R9$ʒt #G_DJ %E .'UdMqQG5/Xsgt~4lO TkaƝr/u&@m|\Xc3s/%@/&W; eKn0P&>HpV"H}~@u}]QӦHge0ye vp. q-؞GiQ+e|zH蜡(>G;B4iY"Dvۤ'${snL# @)DމC8)`.РB|Oĥn] ĢcW7`oI`#ڠRi^w;ݿQ"8#Bq<5~?W?&  =‹jz÷Nk>ޮb;׌AbXa[罎$ԑDZ硽H=@vdt,s~~ef dEt`*:"*I = ĥjhp06opQ#Բߝ D_}K=u_/n6ܞZ YaDEgabC$:~}qGyvOMb^dPw'@#&(+z v+:2ki謮/" i͸J#GwQ/]!윯O0lX{O^:+㮱(*ũw\|7"Xeb!oRҟ _;+NOOƇɩO&fpH _UP[}J_J UkĈm 8HQ$@NBS?68?wL}zG=X!flzo:#ג?Xi;uG/Ps?ǑYfV"l2.s9D <ђE&كZXr.|\t D@xbΤau_Ok a"kK"(e?[e秫87a?k#Rg.Ѩh!.)eAW钟(yy%6a"5a$z%yQPMuO9Gv)3$Ab7,,$u>nA&buǬpsau2a*LFBa Y0U`.O̫İŠ1^ైv/'k@Fs-[TZTGUkJ J\굚 Ҫ tY1(&tey AaLj y? ,."2;d M76 @ڣlX5BUjDj4<~_3d-6COeF)C2hta$ aKkJ}J~nujBtQؿН0HMp;]/"2,EpμPŏݹkRjMV.S.So2шr:VwEF>ٱ}Sr%?n~~ePӦlϮc P>~{: wJx i%M .ΩW1 PD@?DT",QyrWI(}{mUx6`lX8k|i?sxwrh$d>nbP}RmX19a!X,]gBv+~s-{Gi$`mP tKU>bm]SkP h_SUP O.w5{kȄO~:Zaa}$Q>B #G19!ڧnSw-2N|93;WNc\w'k8BxWw59+Fe1tGFŤ赸ڵOәYjj:~+90"$'/D 9y]aU-r:叫YEMMxwuUv7]b˄ l*L~ʉR,w{ݟqy ,4 ";ZmE/ ]nLt(\cS=o%0x==A4\Qt }wںo=P KBR_)ۣOgKP]嫴.@@G `,l4MHF,!yV18z \2VcpVYn8HNf |fN8~坌~Mk֘ @0yj|~` Ģq!/Ә|3IV.>৊*%Vsvm+|noUϷ W2_M?جR@>⦴$'ڕ/(Kg|U$*kx-#!X5ckco|im0p>'a/@twV)Jw>":no1za.–΋BmdXG\`(%[}ЙBsIe\F)b =PI)|K 7}^ФXJ|D!lR ^n:[隵t@p(ػݻ}5Ҝ7c/=|9?uX9y& KbxyFO4Nwx >|7~UݾN(NJJ>MYl & R%qTT$M"hdQU6LvNݸ1_4NϨ CV*}p}VҢjKjT~ ;u#y:x 0@ܿ_7tZw#{u5㕆{eS@,/+DVamw< bp/ upH2YӔ"E֛aPmʖ@3d 4;")]ϝVob5 sƮgiqۆl)u&!lnD[g!MM Y~izÊ%co1k0,&˚nCrMGL 0 ƛ՞{: pTʶ1!NJFnx #vf'-c筇kJ@Se[iK٨aіB=꼩p[/AMMG1<ӿ%nGzvETܫz;ꇃ8|N%Z!iA<[:lf!> b Kʇ:N*A'k\B !$+:INhЏ8j`Ժgꐫ6&ο4V}oqIiB4Y} VỈwd"R "ơ~kN?*nա⬚lZݞsZGs{je`E.P (ʑ{yRWUѠ&LT˛:?Nsm܍Po 0<:_4Ly6= ED>s[Bݪ@y1P>V}8R;ާ@ IB1%J~9mKnߡ7ȅ4w1͒:Ksm7?~zܙ [pa9c5Ot $1$2þM4 { t QJg۽6Aإ 3 ' Mg)~7}9S{-`&<} *ws{w L'iG}gǰHy!n~~ZA{+VjrT0-Y`D +f;̎zygԫyAlOwX 8su0&k4 8!HE ]S.ɶ/o7+{R(Z]ݜ,wNh&?QIpb̙rmԹ4&FoO.IUkvM0|dgUɋŇM O(js{[5.l[Tfa -%&²g<6_;ۼ[Lȓ`~jCrs6XEt Hq +*auй1DJLIN;#Qm@w=eM G+Е%hԞg욮 J!{Ɛ^*5,ǹu^ΆZDgYj-bNj?]+$v}6w?SRKzʹj/ Q(A; C_"Σ^L/PLG Kboy:bj!m-"wW?ǔ ,eF v#*V2hJp<$cy"yr?}"};y$$9v@aBWLh\WM툷#yY?X)#K?<brԒ+1K)J@*Eՠ^e<'7ӈ/3f:mJKL~PtX&SO!5 SrK"}g(M:kp15JF+az_-un!Wo |OE:=RY+iZr!ъKH]o.tιWGbXL+U6lG2=x]Ca#3!e[>HC*궞+,>cwJEo)8.=5D(A ES:Dϐ;f'h bϕnһX^"v-c>>WmvJ?nL(. Dn7- R/@*weunk4 V7Y|%X%_,p%qq: lk9%[ւ߬N_jl!Ajs]EbVf (st \1FZL{oeDT)n (VLF&ξH5RpCu"X7IL  u ȡNcE;<8;F/6 x0@/!ajIi -ixYgK4'"Zi;)}w}#d$M冫u!.Ԙ(Bm䔜670Dw-⢢r2dZTIyl&Rd qьӡ?𞄩>j"\EeuGTQ$RAO/7)PV1 2`زoFz%{*lЫmd2" d,Wcjܺ;h*6h̭p[Ajv/h[pY~8"FvC$.rŪ;/^/xl5.eE-nl.'j#I0֑QUSWzڣ/7OO ‡=J׀srV++S's6-Pxȕ `:ZG+}ΑI!ND#m<DD i ZC#=^̟oI`PWc%NC0 Sl7/cvS fhe ,?^63m֪-VR@aL,v|:>fa}a` ӘH$@r6ZֱMZ!f}Պ1PV&8[6Aq@8w -.` g v9?7Oˆm3y'&P>ɌE{$wTSv-=,Z8IJ:Ae{{U6y u'`Ͳ+]E5?{IwͰ%Af'T)_{\ :*b<aO;7=>bWFB}z`ĨzT)K?0c2dq[LVKnh~U<ƄY 3ڋ5,~{ti;K~ĠgύovF l1m=Iz_|\ER%/:H٥^$؂mH XqգO%N; ̯817rРB&3XuGKެ%0`G 1v峏bAtfǩQ)K9_mo#@$Cا!V;`| [X }Gzܿ1sPR u|B=O٩u>߳.|lHCFism*-RJA%] }Nɓ\<ÓJr,x? v ؟m IXNY~(_9OWn{rRӠ´:/oR}[7HOG v0ʲ*!9|P8zL@1Y]J<3{@HyoHMo2-0wlU漢EV}  q B,$0[qVfn|-7ZHaH[4 _hHNs{kI|&ueo,9 7~~f/o=Vims*PyE3CH#k!(ZI 4Ȭ{^f+GJt*0Y(.=o+@zɀn{H1 GGGG/E T$ʍYHR8%l#QU~!KC63_nnV:%ؘ>*BbCOq˻t‘"ZZWr]BI~i=`Y3l{ջ[O' !%țLsrI<DbARSWm HUwCa|YfRzC.c9 \FՔr)fE9YR% 1f:flזޫ6ݏ,l7٬p oQzNu [L̔Ժ=be:`ؐ1*aVb+wFc?Af.ttXr2-L'; % bviDȣBn r-|.7KV9.<բ^ǔCY h>!D_5xR6 ߵ#l_pCCAcj ) f3 gԾo&vR~mX{Sjܻc.( #F;eL*'(\AKHpX|kg?HqF񾞆JWAȯy'6 &ПSov=1o} _n})YsWWA1@>.,aB!ݧJ2gP>Q(z9BO&Z&"b@GsϋUoant*m_4oYÐQ&&\Xj=PPdz/fD8xx4v'Zlw8Hν z@UJ {ckxwOdBC-=ǴvwfCwwx(2'2vv cJHwrK^ ~CTӥ8xNb;`$M"4&YF;1!H\Sd!^gvgeJYx?*c9@vz` !ą4Y`j"˿p}gHD@5BC BT\2z~[YlEd?\Zpwctj- ?`x?)kjƆ|Sn)CYwݾaƐJtUԾU6'({BC¢䲇(DTn87⸹"\^#>)w`wYi|}Er|aC VW,pPjE҅d"RuJl ]vx9kإs}0X2f?APd뚍 D>)\/cC,Y0 ,\㭌(&@"RɌ46R$B^$ ?$.a1]j>z4[y?Mwe*F( 1Xx[S$PE;EWb^:v=Dh#4._.$BgSvwR[yYEH` .!(/h{;P ˈ0KPėOH!TL82]t&:t:^Ö\D,]PP!eR1$$XB %۷< KI]9$N"L$YӃ(EnLZ 9DdBZA eLTP]$SdR*O#^#A$ II3[}6Zgp|\fڹyHQ EL_rZx4d[A#6w>'7ԮF!>LBL$_TiW4?=T!=QbӞH@g (-[R@=ro2!gjf:#G3*' Je._ rG1 $j>GxgEǯ.7Hq[ݿz ^3B_rI]@FXIY3]C8't Rhn:]MBh/d0oh-ѭHvU;̜4oI2|T֬B(w}'lsO@oW+74pI&b*=o-1igLFTiу(pr|z#yK_/Nn,U^H2(HgAx7zd"7++>!aQiRcчjԕ-fqQ= 6;a+IZb,|aũ8(<; ^D DI$ՐaL;0eD?9Cf{a7XLϻx א zy\ݚLbYʕv#V͟x>TZ={3dPa>fOttKhD+FsN9t2癦|?)"#`jPUZO'p}?~$zZD 1A()M|GI]3oM1M+&J*+3A a~ER, '@ Z (rK<wJ (D!>S6XEgڃe"|Ku%X FXK ŹЙ%R[ж庨 ۛC1'm% >o|Ik; TAE4iŽ`Ŵ+[N% Vr;%5PNMEo1nrM=32 <0O۬zQ\/K/|bދõqARcp<+[e`rO7,wޟe СFV[Z$:UreکNsfUݗ3zL霺7cV~EٶZ~fv HdLmNf&ݲqivzL]#9i(ЅyڶY:r2utn\ 롚-56l D)Q*C5EY2.f،p9a3eq~+[*-%t. k*:-BI'BW=6TkWsJ}#mvx|j;tqiSL&}ffг~ukr31%Kb VjXǙne|l,#bѾ5:+'KǛid4%LPXM S5SYo Z^}ρ+,,?骎%,LEP%Լ@D\HR$Ȋh^ 1 k(/?Od{5JՐ.gh9@ܴֈ,Z}>@["|ÁE>GÄH?ߧ`wlv"1\`TU5U_|dVxd;g!G f-{Ͽ@/%GדCB;Cx1!_D(st}`ElA;GAI#J@;N=}xl·_;7TޮQ9 9Ic,"G =ǣFوuX.B%8ZEZhҋr!_MJ/]>yd 9ki(Q9I[z٫֣!yH.LE~2%! XUȪl_ɇaِLaHo"mfz$v4\H@۠K+ 7ZprOHiDdD9A^b6t8{j./WॅvDdwo{SyrjvVΰvRCRNTO2ָ9yi@ 3$:Kc)J^| l݋0TB- c-Ӕ $  1YJ9\F4Q4}-mA;˟I'TAg8g ${pf [אrP7YJF'7G?;Nj,#3M_a{QY TU{ ~(E d/[5}ӏ f<:AJHD&拎/R%N JBZm|Odž齑L`B!:vy;jYgoilg,P[(TE(1 ѫ;?.r;\'IS=hAQܜ f@g:bOͥ6 󇤕^OsUp^\exϴ0 .jm5NIjث>3IuЄ)?wBO׀O+a(xߛ`W5}LkcKp0/YEDsy} i} $@v[Cvq oi4w l-6xi A<a ⿮*2!2!WnIfبX{3 ^ӥfvLvm Nxv>&mKfB? ~>"y\C`@?azpG k;ӢPFá(0dk7 N3AsXAGʹ/QR/q2Ϩa;7͛хϱD<5NoLhANgC^o#bOScvY@gR #()mC*{Ѝыe3H.o#_oOzZ0>Z XCDZAbt|3%h|XW~$.~M%( es$'$ӺBw'yMWti~Ja}=n8?"4a[0}&27CNkH7q6 F;Aq M&cQ#, hCTrls7dxP0s Q سpaJ1G\֩ڈ}Lf ;߈C a;Ǝ:cE}d e!Gu^ph* 0XrŔ5M  -},Aw ': ̑R2ZZ1j-_Sxƍwz8MPkz5S؁BDUuxuc?yߤ>1 x<ϝ Ia 6+QTVmQ/4pA>ex2j|8|cJ@{l$&,PɠR> 2V(#ْ#*Bíϋ/kd|mN )  ZIiD[ E2A.nFpB_bNVaS?Er(S% B,U)r_+?G(r0&~(t*-zjBĻr49k r%8s>ǧ79Aj,\^XpDGNlƟ.<:RDmd]/觻Z%J, Aqd f \8ǒ/REkM_xz?+?y̦wES;CMŸئe=}6걁<4,% %$߰/ZZ ݖRB\ !,=1ѧ|z77mY9nk-FѠr2*DY*W&+JOҿaA]BR2,/0 8hGLb|=y[smĤu`w.,%]toϤ5wRkE`,͘N8gÑJ5 wo7ڛ IEjkce qP7FQi,6Ṕ0 1Xʪ~ՠ4$g([P zIu\ OPzPbImZ&hY{!fIHIB$Xb-n߾fzz0i/5&3 MRdOnmZEh89ҬN{bjј  1!u)FpbBP 4"JgCuu;@jCfw ƙ b.0YPk?5Naoh@wJ,J7xyY"u }ʖ VU>mM.^:ݸe$0o5Jٿ&_gv!\0$U_nx atWHk#yGZAnfdٴ?"YRV(Yn9 Osl1#:gFnnԢF6~\FDD)Ԥ CfheƮT/wmgktN }h?gMu8qM_lD JRu ^h3-݅uƢ7&qգee~%A%HX Hy`Z{?s3`?.DTD"XPo(pUdg^%d YXj9 B`z@\b\)ܬ/7[AڰδR t #AjTбn !F.WMZh\{\ȣ]sf Yb_KGa7mֱ,s1h%EDoT,flBL7U:_1ΫgG·56kÇuvɋ"@4Ii&JRYvQ@jѽT/vs.x\x4P(6 O㛹Bya>r|ޓ:&EV ɔ}߮n3 \ӥj΄jEw<[0prYbN|å̛Ւ9Uu&^ϖڳWx;A28ж 1eEu*",HRfMQH LTE`pWYZ`) pUAu{}w3wrݻ hHAB:|bf>qz:w8(0w7kH?Z%* Sp)Orcge5IDEvmoUB4許]n٩_bjW.k n&f.MIHMe?|'q)xZ~k1YQh"s_~WC?#jJ\ufCS~a64tqlER^-?67T,)O i8N1LB=AKUve/xM8M񏸓_$IT@_#c8V}A5Eô6W*T"|< ίN"v;O%霾໙9ߛPX0Ř?o{0`=֔N;Pcw<_@Rԏ}8C\$"-1[?Qw RG 4ɢQ?.~TIfxE8 _)/rzZkfhF 0VRtenLE1(VvC% I'0M^V9 c1XG7HbC%L G?Kj0%2qjbړԼthI$]/M tBB}cD\=> ̐vF9X-{<`>5r1h"Ee!PP"])I}Y lPak ۇQl~//]GI*D wo5sh!rFj"D^Mi1DK"W2(.Qڕ%M3d҂ "hMF=үuR.m bsr4bJ*"q83RtBg-L\aks(;%% 9 촔nv%|BwQD쾍9hC dM...nYY}M*[\^BiS@.x G#&VxaplJ_`fSH|pJwg辥VBHz^ɼ{/@ٗFuJnv˷<*G`Y1;O]ϳ}šCaf+2f~ot捾㋱ˮW_S ҢWT8ly}}?# ,nEXĵ#3_=*iHG6d(#fx{*٘~ZN;*2gҼ$f"Aq&LXni-5p݄ 3Ǹر.FUG]~oj"oBJWF UMt˚(a%+B] 8">ߌ,n yw/;yúo6?);ބ mJq\NJᧈ&lAh,6|W8QcUDA6sr3~7ow,CE:4>I !BQF1:D@ #O( -'ڃU&/>UpJs6YET~"##M 00eM[9?;I>ՑMݫLA?'X|(.K!q=$ a2o53UZP+wa5S^Hg"I8Ĭs#i "kz~'Z'Q{P?@$M`qCBjhe7>VD؎{0L"-x+Ibq)HöYq~sk;֯9ogpX́ !0E5pY9; T'ONE%-8``Asb\˔6" qfI+yN短Xp)|ndguq}n4Ɏ29\<1SlPocבZ@n9{3H\7,Xqb#!?~ˉם;6` qs8i$THPjR?0L ntdG0!!#!ԜL( %wi"pEvLuEjz3 W iU#.alv9o8* Fƛ^.AaH'>1*y!I<*`eo!8@iw>_Ji UlgA"k\ ,yv//d!Peb6b$͈)Hk7t`7?Hs[mxL_h$\S YoCl=D}A]HQl{G $}DGPEi;UB]\dsHvjM\-:vꕐ}-q}غxy P~=C"3fAA/&Mv?\"EkXɨ(SKt:^6"(>Qf+};*<ΚTtyu:w%JU e'Ѝ8T k5-i$#Vf3V7T =MX?)ª-|~҉&tcF IFݛ٥~HHgJg5'C7TP>CޜV1)ꇫvmlWwkNT5C%s iM]u~t~į jISU}:T[8в$ /[ٻWiWW[Wi7.Jr2/?1)Wÿl V)c7ʌb<8~c#Ec{]Y7}@<=J.nm1GcjP :' IJv8 ]ef1ƲكnΫ AW(±5& P lg=Ayb4D "AB1\zU0V 2~Њ .L~h$B񇈰ÞfM!j#<ϴ˕E,6 t2} Q)?e3I}{-hMCugw: φ/@@C~'vaeQ~q92_B?cU@6t; 9RrEHk$SS!eܙI5:EJvI9gm3k6A Y *,(zbr 8?D`ˏE]uIm4A%JLn ,tg}mdaz6E*/s\sE$s@~8|^atZ{`(09\WudCC`` ((@h 1˓?QȌFיA6 $+7}pOBwt0oy*CH )X Z9"$tNKgǫCC{8sмhuMRp`!} e?Jj[߅YLy@+ǬirXÙCi*̵*:`LuǒNW8##imӳu 7 BU52q~a|7?EȜT[o{"d$Lc\jj?D}eyfmqu&vv_0T@?ҸPCZ¥fX0JOeiq ﹣G>E45bպP]?)Yk 0 Tppp#Z+o0*hU4t |o)ǯ6"T`D||YSS^ګs>apvҨsI]Gb+Tw*K|zU4 {Yh0(H@9]cItS^1$÷-x8o]R|fᨒ|Q@',8JF#JukLh;MtB'<'9'sŌt4,c7*우F\[DSo?] b@&xm:MTm٘ ۫1( 2GǦHLI醎؀zDD(_cI6Z2Rj,䪪G缼is5j> >Q6p1d0$6$L^۸b32N;x?d [IRv&L`5]46@a[$5Ljlԋ-6%~P4J!3oi(*?BFIQd[>+x2"vя/eyf+k! -GעQb5NMBޱ]@{4RUE8 TS4l7]Jf`3d_[,ވ.U@>sf։!-r n!MSAk 2Ae?o0l)yǰs̤!V] f wb ˧!*A` qP8rMI`Nx"0qUDgofh5 n ӌ_7y.+4HIo7-Ԇp9na6&eHե|.]MdPSi<*cRv00ŊK| w"ݧ3xM}f"RUJ9T@QH DyIB`,9:ɀ9 [b1F!PQqK(X2هRʹB=p6kȕ3?Li~V~U,|>\}7u) @AWzv;#dp 7f.#OvXhr!wTaDC@lHj[d$$GYy{z쉆c =:-??Z18c\ve 0*qiIENpt,sEWh K dHPc1 DJ|k3;4F$92\d3s E(i#a>fZDbtO48yОAQֳ\s<8I>sbdF#er8C̎:ry DY -})=iqy, GmCf#B7PG"p;dˎ#%+g^G>M:PVkyH9}iӈE@_j]g,$5CXl영O#eD5*I PZ'[==tev$iU&.Mja>pRDo*%F3UPRL:8rjwgp[H=pkyE%/2D<#B4 X\guΚt>93s klBP;嘈+]HJaowdІr롿.v9/~qum6}P KtJ2= Ϫ =^u~ o$ʺrϿT{+c$BFG GڋEreFƌ#p69%ߓ@oȜ% eǑ@Q; 'u`<{Y=|ۈ$ 2"7Gӹ)6  XU9D8c (ڻ:g#ۛFi]&|pEn,o,R0"Us8y$"ftij7b_ˆB}oOY?0*ӝ@ңlyԮ/q׏nMu[: ~Ējv o9t3 2m/Hl<-Van]Q-8 Z5 rka]YbKZ**c!$$)*0n$>IZ³ iHфh`:MV‹,2Z6\#9Nj'1Nhxw0R"|A2u V ŃOisi) Bm4?ǝKGB<7<&h?TB2Ǒ*Eg jɰ|5շA eVҁ`;4+Z5{aq] *?!rGWA%c:' 5ٌ@܄,qqQWvT&(3nijg JyMk?M[+t{wR34ah|lESkn8kOS顭mG^K-4K[9!"g &tdco8'/VbOF\* 1.M7JDT _C&WJ#/OڔsPؔ=q}j 1odv};TkSAANz}q,l%&c)v-3q_cdRD;2N]iyI\>ܰ紐뎗HJK1 5#spqJBT%K43+Òߐ!HˊRgxj=Ym8"Vd.)稸XSYi6NgMiOE}6.Ee8t`6뱷\#;wNl:OY)dc >0{B`VJ-( lzCUnw՛?!b} R}+V Um9Z3Ya/c;(Κ #&*3|2? V4 e47q)OnbPK稆'hXmj݉}WSDgu+^C< FNS;6Q;Q %`vY,EC&{$fU<*\՚&m>e-Hش-ɞ:։ l$,CH sQ[y!rpBc1j,#gBByߦhXDAxhHPk塖 /dXUX8?aΡ0(2%9 Vv_9 }|Lr=9ķBU86x|[W-2\'f^M}MJq z2Fw,4Si+Z]9T!{3]z-B@ >V;kRѦQrT_- /]5C2o.;Gf߶I-A'H.ZS2$4 FglWY8?A\)IbzSGXaia/Ii[pED~~eY!qd2(J}=i a\z:֍Ymߔʹx4AMGU2@RrF{fҫ ~n%&cצt9tRp?EEv]tʿR|L2dvxh/MOcSS' ͚|(W1&Z>+$ss`~r&lj Py&N6-7-@(DmObn 76;uȉs-ڰ4^.kFeѱ E1uzT,vyٕaj7I {ZKя_DRƸ )!r?stg6$Xc+ӺH~t<6n82 Pf _^uj7Q=tnŐH_86L'&'9&M:?t: a2Ǒ1$? ,TḂSC^P36]Vzzo")>dxÒu;~ZW+g{}Iȓ2[ۮ~*?/˺NA=W>6,פb ?P'&ZOV6GN+tuӿXwYu"Xk2BɬɼFa'/Cu J cQzkv,ml a/V;'ٮ(tEt3\5bM?,/R'4oV¼+Vl?7OȖX,R2my[q vo9f<(`G[/5<%,w:> S,FKaƦn:kBes uo>loa+p8g:2i]$3՚Wir-P2hdeR+Aw읖qNQn)ρs|y}>4~9=ylOiN#DgȢI|儥:ݚGpIN1AVz?m_'/جeWQB I<jr -q#BfUب7*[wm=0u"|!`~}og6_1=&ۉT?T1d砀'cL!JсYB;P01xpS ƙ"WD3Z#*vYcprܸ6xIyⱹ^x"l4Rj#_nTH_ ϧH.V@瘆H3rJut^. b>t8|m]Ph.eX_8^V/0Gek8}i?J}.}#PX^BRA+0]=p=# F@ >>!?jJ,:ܷA&,MB$mw< W tr"')؆ ,e15$r~㱢?r  (l IQ!OfL~Dԁg XS"MJ=I0qe~dnȂc6SG|Wp=߄ wrD%jS? `|*+cy,fm*+u*\8rHyi.دht BЯTs0aD l5dg2jn^An6ߋFY-2U2OMF(SO2WZx, ^).:V:p4@̢]_s%ĕҝTqXrz~7cڦ9Okɏ\0=wrMOaCy\gU W\O,gg, !{h[ozٮvbϽ騛@V1Օon',G}t0K{jTƴ2*lHYw&RcjB ^|=G}P޾0)UYmq0{Bn]D q\Jzk%R/$K~>x4ۅ$q?Ck/uLHٽD1Kkਁ)D,+|G6nLZ i+^jQ)R* S/MY~M'2v;"]10R0vۥr0ފuڐ7s.фkNBzr|s~p%Qjn Q.},&2t;KO^<oy%!nPx8H[Gb!EYjBMb{*&SZ1;;i'f혤l NX2]VkӍ1~um]nJºˆ[5.p0Eq]RތVDDwЎuZ{#g%Bm 錨VzNerV<7t5CJYj_G??B?ʏrRFf`U>yM+`y|$=R{=4BHO2V%5Qb# @I>iTq,GFT=ϼ88Oj~R|;(m~Y/W[( P=-tӉ:^nخm_R%|cXjEH  :$kfBaWs:HHrZmuYK%l(x^"A_%8PǼ{iQ?5<6:B(+5Z)V)%]oNly1TMwc?AĶf1u5%\pTpc(;|U3uCg5e? e{uhX« @U5./3q:퓾p2Wݛm"qɩ*Y,bhCt=?D}o*b*/ǀ^Sn\CedꟅ /H©6QeecY*Z,EH|UKQ\_U+MW?+ۨz+#qh#.44(صTdXөәd{8TO4amvK`_]mL!;jaQMCyy'b[ū448_!awhZחPn =@2ʉ+Nz3ӎ3\G~ܠZ-u')`a@u\vu7qS#Q*)rJV"ȥfgPŹobNQ㔇$}j/ץf-|9b~p7N\& &Bf$;ur L[E^A;ldzTHg`0Cߋ;tyvؚXV4)M[Dm22O u)-tNVwlo3eqLv&f קLD/+ U] okcǴ]cөխɠx=qrp>ӆ.<ҴtN޻H.RsliTa>8.^_t݋-EP!SFK%&]+*{lH ]|r5_'iV-v3D W$ovuwWTtj&KLT;k:Bܙ` q#%` I?h7jwDshHCbްt<~( 4Rn^;$SJ7]B?"sj#" N=28o)ӧFiz03T?akKC#"bf~L} *v[$Ԧx+~w3| qbb ĺ,_@>2鍀g{ O3X}2e`+?Dd(^I&7!\*J=I3e&)t $CL1hY/rzd.zl;e#&2착/ZoC,軆cELΤξ*KwɧЇao{s7I~$4LF`zo$'xu4+PlԡF#Cg]Kc0iQFs^jnUg8l6hi-`’ˈK3>z(4ki K_!Ѹ1Rd˗2H%˵dPH$A~:Q N_/6\QIPgexdUSL~EL`%Nݓ Sɍjw$xbbCgbĉ#?ᄿa^ I5N&UmE#':3ZV TDY?U5~SEs]xs-DB3ّ@F 3 v(_VP ;ʂ=#ph6" '͜ը&Jvu-R?y DYzexexwF~yn*qT8ga'u? 2!E ~vڡ%d`jKq``uk%_3ޮޞIq3O94s iMlD5-c10et {g;> q*L=Sw97Q5~3Y4;^cbPD{|%p@713`gy9VDubt{,n 8*ŅϺ9oXth:(5zD"WiP;]oW0\ Lp>\BlR ɨ(׹bD׽1Ȁeݙo7-sbILDB#|m+@aS# Ț#Ӿ=3:tM(P??ɥIMWHo%wJ l{OQ;;:JF9n ;_ Z؜xƱ\+uUB{7?M"E6ġ3R! 3|US%f[̮]hɼ|rU,ugz0^(l]Wl#TUiHuD؏›ᢾU)@rЄT|A5Hr p%x"o: $^\k;ΣKʹ6 t.z yGp׫Zճ-X"?E;5;qgH]á6vO,͖((#7guq:Ӓ!H#,H]Fc="Xh]#aͥ͑]yW\UD*L}}UV)35 yf8'+J6_?aGC7z] XrEegYB6M2d+l;L\g홢ퟵ7H5Xjh{`Xj5OOR5?̹KJƁY0惵Ǔ "Zp1ijkN{ÆYeHo22p=v[x/ȝVi&Xx6L;flsթ~K&pO7nA=)ȇL@"\zBQ,XSTvōEjnZBkd1uayK½]g[Jt:mDisz#rY@+Nt=[^:KқDEFe*!?9 csNn@Poz+/ eX:nk`Hj`y0 NJ)>U.XL~v!i1FhLTEyoK?Zknͩa(3PqD=X\8pKlk])x{HCwl?|Aɴ|Sn̗P9X6&Vozw*<;rZMgCMH7_Q(#zqmiF*=D)=R\TX,ITv F1^Y$# W5[ R>loY`1M'#U_4AK8f2ư }ctC V~!gjHϝ7q)qfw uCl>K;?`9X[wՕ$kV6~ Qܼ3ǭY.} QZX˖W|g)Èt?0ZGĈXh M _皚Go𺏳%jmbw8wO5s:9i;~;rYcΙE~8N:#nR[r('5\KDH?UGHLD\|w¥MlQ/_ h[2unuOn{g çxR5!>Y`QKWMEUjvXD╰ d³ΘM^_1 k˝Ʉ6Q\y=Bʯmȯ7:=3:Q~/ܑ 0||[S\C_Iyz*M_Eџ Xo|:st(Qv+7zOKZNZR5#;Q2" kSnBPƻ}*b>DjoX39P/ڒ!mLJ67`>AF]<*;vqGcJ5'F1wjˮT6i$jBbR(v]`C,@[7;؂nc@BBueo){揺<'&$awPc #.e7n(v6HqsKHEjQ3m7D~]Zqn se9WL1Ds`.',ZL.u*}ȞNS?&MI-G. |oﶉ#!v摴mZZaUH zTH_ϐc0#LXnںa@YV! O8h.e8Q!mx1cr:ŀ=VH?;|yRQr8|?4gC[WYH*()H-N#mę*W1**wWsP޳;dvef.'6ȘKD'wFo|mFRbR*`o}LqkHRjHb rt~R =N0uv=Y_X߃lU]#eQ%3wx٠Mp0l*79TJq.dO; @$o&;SvXd/_NWa8r&$j#,.rV.j,zZyPEj4˰]>XʼfuȮZR\u L/P9??\hA@Gj^DcHY] 6RBKⓂiUq~>N^g5q,:s"" V++8b]{HҝY)Vz@iQWmv!>zm:|sVR;vW1 x%w$[*H†W^PJH@s=#;3Am%. JWu\<4= Z0Sg?a~2!=8S.om.vDy}?ϢT['/WFÆS%GTfxH3 :A">'BbA0WN[OO𠯔*r}^bi$4# \k-è֤b0(iBdhuK#ϤPe5vYY BoԺd`%V19~C?@= e[Dӄe6`wЀO雃-luotO*0J+Z} 3}K*8am1%\|F83%bEƁ>]>(G4t?fOJ~f{Io0PڱXQaBͻQ^v[3WAգ=Sxr`MxJ6Vm K`r{+C:)_}CTkk!wCn$BֿD(V9GE)pNgHs K4`i8mh6틆Ir{r&VOC dH Bޘ.]U2x8ZT ~:rT]Y֓3%Bwˠ!< ƂlY4!yZ! -R*Spo@./Id}y,mwMaO.1 d䷷s6C8_QoqUWBBv̵1V@۞RMŰ*=gԔ@f+W_FTLbm~afXn~[gSWq-[l4G`tC9I@W~#`5\ a[HKaI?Β)˄)Zk- @U%WBFlvb_vQ9ui,X/UrX 7},6i$ZD֊~ִ0s? d/CC m^d xp"ϱQ[ DCoܥgzڱP}EE$ҝruo.O!Z eDʓ=_:A].k::£"(CjT 'XoN#<'K{ sZ'pic4(ݼy`<&6/FkeL׀`_kP:o䑫[\.'h-HhBk"WYs 6-jF"hy@*EhJxfAvVA&f*E)&q08 c qҝ&Ё DvTVF Mg6c*ڈZ8*Mj 'XNZD7̳e+`pU:jQyeT9N0koKc :"&> A~;ލ+Fp۩0-}LcrLBf~f1 +C؊Vߞ2L+i۹ $p{C#2OJſo6LFwsƛ57D?Jm0㔘Es'zݧ]~ O +*TZ\*$%*2ġ‘5/:s߷ !NlF$f݆`YngMboT+kҥ5wJ&G&G~7 Gp1kÖݻ_;\72Ӡxeڑ If*5ϚUq!R?ld2«V@ֹj~wɧCxkzkv 6kÃoXM?CՠFsR~MvBL ̄r* kX[xf(کƊ[\@ !j+{;+&: *Ec5c~T-fߍ0 ,EW\`sfZEYmJ'@eNFzɕj64riF+ܒ5jxbv1W#>@Usr'QX/v2)`\o_4i!!(}B>khH*YrЀ?nV@8ۈqy&FEJ6!#SԊ?,Ti (H^Y3.3cR>7AB5_nM0ozHj/ݙ/֠i3Edl]j!3.aSuD̵/lN׷1 uinK|Tq7^1x_G2kJJߛb#gWةҘ4VF ^'c~Nꤰ-*VC!oJ]da4vpe'7_>J#l5Jp#?yK] ~ej6`r1[J?y,n|IN":WN `.޷䒲}nC DȘ,KZR/Ȯchk Esg@"{H8X}cOdMNe@H8ď-e2rR /| 6S+@4 uH痱Gȣk'S=>N7G߰ܝ61/sT$n8YKU!L'p|B D !6pB^z&H0M@PҤNm)jLLfMtD.d2os&8J Лj^m)%sobEA_b9ěF[G\{+fgw[h"çf : ĖWf2Ir6Sux .<޴&EvN ֨f QEp }ܯ|hZ+{WQ>egBeics9QBAꂶd㭐&v9>>0cꊳ@@Uͨ1,G"P%Y[ T*ii@T;;<.ťǦTs$Rv2/VѪLg9.=ý15<̣izE-\|ё8B"LZmN@?Y|/?V6ɬ.H0fܐȆf( v&BqԚC,HGRγ=9&u`}eۓJ*w|Tטcx2]i3,rIأٛ+GZXGGjw?lp9`G"+0{ʀwvC?)DS/hV,.=4=]<ݷ'=6R7TMj3V&jj)j2#T;1䅹/ ~!0Q᠘n)0ônұvg 7js\4E:Hy:G>*onzA|cs5*YQ8b/:?uN3NMOҠ e^s4uN*cfXJӨŸU2*-5^%WN%V9]l!bF?ݎ1,dA,ij{haG2"\lZ/9a%eaV<2{$OrЄ{cI@J2xMܡߡ{HFDάZkFZ׍Ȁٿ8K#|5.apʭZ8W (&4s3p[B9\,%HTUŰhIq~Q^ooCȤ~?Y.Deeќ=\ڨf[\\"E%f#rѾwRX{Ydbާbm& .p:odXBcs3ݓx̞I1,K~e҃2l 9\--QUR9 zsry־GZ*]Pm ɝ/4XX}l`QS ! &Pƙ&?m OW"Q!mlO7>`$zc.|>qԘ+4v[3|u߂\T1 e/3`#\m\m$>k6 E~QHLx9f߉,  `ycId1Es i;Mo 3_6,`pK,K36 RJ*{ .,\4Vt"֍w ,ԨY6Pˆ}ﱛ`N8չWg 1!3T|vXHSopfc4wGIäu_q JkcbRve\|NP2`5WLfb=^t 1>ؙ;S%o*][eqc^]Κ`B%@aw^ y)>-Rrz9$+F8x#baK["+e_ G5}hM0ҭ gS0e/{a" z E hwVpz> '$8%]M^./Jj8¸@B圚}{>w񙆭jbnj׼ʥƸݛP5a.OXo D"($ir7xqߦ%^ f;mP!\c"Ma9۪.LŒT#PjJTgLNqx H =TGs8U?cTR?#nKp점ǂBe6pnP*ÔO yi`*Ѿ+)eqpf!bcG&ق"t& 56HH>fiؖbQUȗs{S20Kuvgxm 8UuVga蛜rO%d]!O_mQZ,miKM>ӵ WyQAbfB }O:ڬBx7P+ւN:.#bݷ6<{c8گ%)p!o@" ]0,{p.g7QܭFl 9[ r7 ˀ@lYY"UVjqH bL2˫f,dFŠٓZ .ĬvN0N~rxf]I(='kC )1% n.+/0zs0Pp'dz/"Z@yMΏU lM^[_rXfI!fe~Ɛ5hȒ*Ͷ =ȩ_,#Kwkݨ9^*1-{L exE 2CApfEe0+g>kEj櫨"yzgאKQ:} H)OjS'h{u| ^Ǿ<7;ăS%L>>eX؇p1 X v? q~waP&l!a~Ibr_ u[kwڴuHAo^ȁ*\ʍ8Δң܋So0VZ.X|5$YS},#/V^xМXS== #n#k 1u#-fR/,_T.Ȕ݀I: |a1(6n.$w XbfC o&#ejX5!'vl7DކCGJ@؉: ZO+_{<@McjfnV@NZ΁ j'ީR0eqNbO%ֿ@[QX ~fNi$K hs-WJc;l?X0{dl˨Q&d L>h՝DId&`3up)kyt!םq.ȣtr}6NuI&z ͘/q>{"R VuJ1R.:1>62U. 01)jJq00 ! &rh :M-IUT1ujCJ)aH.Л%{I\c1ч|&"/f@J d1Nx՟e"^yr%4ApsɺR2{͉3L>,YI0X{D+toJk!_3DoĤG,2 Iivg ,P{ dVrtv)>󡁹4&go XpWr5+{F65h6E}F9LS•"34MW{#\].7ůi|$P.YFHwUv+51)+UW8s!(y&-j&w3-XrEZZG]@(/wK1ުӢkx u˃f6 $lONh;MF+AEuje,gnpĎWDNrzحE6;` meZYr5w˫ȹ; WO~v/.Smu} UI_"my g}N=fN=' p_Oˉ Dtʏ>t1d5`p,aL>$'Y߯|nX oͪL Eh'sﳨ2nh a@Oq&e+h| nMAlSh/yQ#Z`vu; ZE_^UǁOf'tM鷡&?n` RGldO" XMh+]z^]'jPpMiDGP\ ھ,`Q*ӎm;2SZJ']*.ڈ&ճpϓ-IJ1v"B *A@n O1fu h;zdHvL҅DԔY)/&,$j粲Aaf\N^VKSvIUw q%'dqZd'^R0XUxF!PX>t$݊.%?^wYħȤY Bu=\+#& %CEZZƫ8soVbG=P0x$WX)]J/yauvNX BjUoʰu_vh̰Yjߨ t'S#빤ףWQ)A< NPEjI%Fot9{ŜW)V[LQ&JamAjA6Z =Gn#Y˩G݊VҔ̎ZYEhgp[EAB ( & VDX/̪e#Xat+0fOݞ4LkM۰uHŎ؝&T.XED9 ߇1~x0>}q˅lXɪ2D{Tk8K}B qjA2뽵hl@y@><$ՅBZSA%N/GAubTGQ=ߟ;8[}/~Ț'^B(ސR _ON%IsuLEȜyYTa8 OYkiw!!a4 c(#9T!6R؝?@r7\0'(3DQZަsm&dS~u!d N>SS֒^mښOL(P6ɱuAh .j?>AGC#4 (&v2l0Bp[3 >yKMXf_!טы"{W+-*d0hֆf8(ހX=@#]s6,`:a3,Ԯff5܎Ue!QDhFô.7Ä'xkMΪ'7ht+:߳Fޅa49hPAVcKshsbrԻx|Ǽ1q/!pa2g&U>AlQ@:! zͶ,$nCDlY*pW܅aqChN6_س6k(ԪFx-s"qu{*J˓ROmW9#[$Y E+*[$wEFj!7ܥpYHِLT ,jKxISU 6iS[,x !RM r6?dWi -ASFL@$GB [alnt Q܃" M x(F[odTXDCu^8$Di,z]Oxf"}r\eu/=`` 1a1Ik2ՅHr͏\h2M@hbį9A3⶟r1֓ut'oLۄL$ zzUh?`ɬ_}B#]t؈0Jys kB15U8M{6pCAR +I*!HoA-$0]aug{"-eިu(}ڃp1Z*r[;RA HpM"e&]?er8AkK^Ȣ 9rmfqL1WD΢nְ酮SAGiۈႣӨ`7: ;)ұL T`̈P\l$=qOp p^ PMIWn? xZ;!+y 쭋BtExD-g ۛ<Ľϩ;gN,Mf:n'/SoQ(XP9݋3i)T~ƣ䑲΋Qe ^vOJu# (@[N[I(5Oa:WeZÏyvD#KTA`ӥx`j. ք^P79--!̡\˫1vYd~ ݫ7%)L_aһ`DW9ux[|sZըkDWS{>Cs2g, 6Uiٶ|8r5VXƞx7ZO`MO *x9Q w.$T[LjycIQ #ٴUtWJ)@9nИ:b&hS]>^hi )I%%R0 ywMIC W+LcE-1O*!fiu\e} ~ iEưO ,u16io +gcqrچ3OD v,5tlcp hDo]K'4d ӑ!lAM:gS~>ut;4EvhVŹNF δihKyړ_bIliF_?|EܸV 7[Vid{&_؉aae ]~H?L2mַn0/[PW=>IJTXDl *tyv_U3Fy)Oawp{׵ -[Q:HW:yOg-@rE)׈LB@]AYOO)FI*Gox #Y9BN5+#{~苯3 YI8`slUp 7'^Bgh ~M(^(}V@.?˅@];k ng8+bS*G#H?g6聯'g 憜G.-U.q_6old;n.XZ+H78Ua8 +kHtU)h#C%oC?Iyb]C^k fؓY`,C86{aחmu0 I^l)Mo(b \/7< \BlOMZ(.jm. ebͬ; 1\ƛ$JG6xGf*b`h]Z̳/[rNUCY{>NmVPs#Z7aEfdxd LJ3Pg/vn^tsGj|>~&4ZS*+GE)Nh_w&S4=1G{Tq5w/Д]66#ZJ$ۺqlP" u$` ӲHdNGwQ%؉߁0207x_8Чv4lx(giD<_2,wB8[EͽXnYs ʰZfʵt87uE iC2APY dP'2xNG3p\3zU7u=0kLuӽ2ge؍fi~yC ~4lYY&v< L{acvRqpҘ)lCKDQ`sf]'Vk"6h~lUsvZI'hFu8oz6:,v 'R9W!>\8)Zм%Tƀ+ 2aQeS@pTjiͱmױ == nG!N`c? !7Z!an5XvoA}25x>I?ԯtסIY:BL>R, |#pY!OwbbO*GŸC+\U%Dbҏ1*|4Z:\eo+ O6{k  oJ{qjTOFetzkoA$[0fk%\lرOWq =1`;пsSq?57ʳ@}$#-R{ofݞwL `XpvWMAzu}ǘB6)*njs`i"CJU]IWasl̹-Y[h>s~I3kyoo8G_retd2.Hpĝdwv ʦ,%|f m:훱nf}Oq_d6l^U \XW|ل~F{a8ЀKգ<B4="[D-\[CNلX7& um!,8Qؙl T헪Vq*_OTyQfKX-l`^2(QfnC^zwWG66l 7_cG֑ q\qKlgi)C{3L >ߠK5 Y @aZ*.傄*!:Bᮐ]}I}NtEn&mg鉮7­er"xr=ܻT\IJ/#mȺZu,;2Rٻi?% te.O󃛒DU$󑂤)0k@Fr ; 7>#ºgE"Z.lZ 7gyZΪ1/݃esr.vj pC 1j>jqlRLU&S9?ҵ jObįIDvuu3r LEֲk˖>hoX\|:̧3@C j8(QW9@ԡA{et[4sx uH$M ,j*&_ <\ q6~/m x+m sQ&bxb+q.gCf:mamkڜQ- :H몂r eJ|󙅭,r8 &us1Q g< -@It%-2q[FgoP[ 9?Oo"u`xv#E΋f_g9I!3Jpz͵C2OLǎψ& [Y,먋"YDm(OZj`w@{]DR8ԇ5yM?hQ֩ZuQ՜tV!f[N`$>jڈ)}PsZ];ABL਋*<|?0 S*)cvRN bvI|eW%^)M 'v"^VKJIc*˙2["|ݮO U\9H6fTmc/5E4NYR\ M%F#p |^X=|Z#@(N'<{wZR`>OukoMsYQNjhwf!QLkMBk~>o§x$xxG"6`c .ٿ !W_˜o99"t䌟B`Fط} b]%YA);}"d0!R/s+YZxrx tϒ)KgN۞vf'ܒ N)I<~ @xh1p&1#,#HЗj&Y/þK/P f1U:QX0 SkӖO}3 1feõT16H뾬RaU(;' Z%pfCWD[1QhQGW%qcm'B&pOJ-ơjռ dV:͙k_=`}q4B #xF<Ֆy09H~ÃBVMP{ R" )+t\Xq_Wy+&=jvmC9,;jˀBFNe$zɞɐAQ7p2Cɔ3LI iueā-+AGeUj֫NMЏP^M1c\帇DHb@HX E8*E*SF jNmkeސy>cG Դ5s8 V1rjh`4_D`HFJ+ s UlA1Įzx1cMO]Hr&@i@?4/f;XҿZ\D%bfGh`vͼ1P:hbAyNL=JLA7@Yn̩y; HtgJ % am~tf-1 scN%\ .qia0^g1LwYfZPo;\wE@]l[T_]R㓉& u+MUZz6]&3&Ұ/*ݮL=O{%1q~ x8%zv[3t1JJ(;>D.v~u #M6Z.Fgzdv_jX8&G=ٻH졳̵ݕbĠ*_ŖjOCa L\[u{-PW?_uU*lܦ+Rj];Y@lQ^P?ChBɈ-'6%4;%k1bo9wY>lσ*Z+V?n8ZNpAE <WU6FIWN硴Fkj_mGo58V \+q]*Տ'zS diV3F̦fY@5 Gc9fqGUԻ, $+|L`Ag`\K!$z|復9#^>og9jFryzz}0_w~;}lr" H%zV}yWEW1nP4 J{_(:|a#U`4#Kz/! K;?[-^ B ;S.Q=| <[KwETF\)1?.[nsOV mFam;[WblQN9=ks? 5Py/@c/(jK̹r 7ZR3,GH}>ӐE>2@E ˒N<_wY \ <Jϲ`ɬIJ|@p_ܻؔ @aGE8+}>rcCn0WTJM..?3e^Ⱦ  XLf%$JF+ۈ8=He{̙gB DWBExG]Fcm}b{%L%ֈ#AbNM X%UҚTSMLg~FoJJi.'yONZ2~t4OVVi3ij>"RQqf$%ۭ v)b%L{&$HEJrHzUϟ,/ZPCH,v:QDIM!C#^R#Yݴсİd$_$nĉ\rizViA Z2Xq!4y[ D'zsq[}gĵt1 WlĴـ۝vJTF=d;^1?Z- 2}WdR^-ښja."yH:44+{lXxg I' -[osk*ۓ{UOnyntـVй`z"ORcci}o|*P'Ԇmpݱz翏.Ub~?my8bnNT9󛾴aX]mj/ZyD\s wy,|vWԱyg;#Kf*q j6ߗyIJjLJ ct8:y RmeC|ټdB:,MX.΂n)N/(1aO=w@.;,~x'K'@~rLe9;(=}aut'p)j%/Cb`DϢx񷘔.ɐA+VğT qH(zdȖM= L(Q(.<+S&eMo;hW4Ԛeq9+ y^ixAރoX]sjqG~f V8HIcF% +o6ЫZ]0S\OxT‹*u{<|&.ݗ"߈"$ FI<'5.*udA =(#eRkSzIM\,!URod5g-!N F$xs$Rc?뫩BOk.eπǫA_~pUm!o"Q8D鮩|":k؝1B, l1 dR"Qg%*m0IFQ p=3L U"N0uu _ OwLjj>|;y3d:M0Iɧ)154,U[{-je6?%l5v~%c*YQGVFqm0Z PBF~١Y ȥ1|`~ X5Q ApPbFAlȢjѭ}`d=@BGAV]/[YJ6qaXJIC0w {yN \8v['@WQkf0#sMy e0rxYW$E}A}}x<觊(VXcFiA I0#MgkZYٚU[p6`lJnE#ueib~/ +ܶ[7S&INMv@][ ( pSL%E+A4^|Ss Ψ ?~ʔ&s(L~m[l7L&LL ߥse㡎mcn*Ϟ,QvtmM.f&N.gK;bM\ALP`I_'nT:G ҳ՝ "biGg XRT5W \rz iGR6-e*]hmژnM~v`:ycq ĺ簛޼5tJ45ݩQ?q+of5[u&[V.PA0!{ ZS= >OU_7T W(^@̙(Mo993|꽢(ZpN*ʙ2kfOv0=EteqόD2ՇN911MwD e㹸O%ԇ N32 n,1=~ne ٽ? 6(~-&sbܭ:29Py5ڙ6Ei؛{ x3!P e!vnUFx?DEPՆ1JNP;lF!\'ݵ*р %-E5>9R = 6 Rʨ/j.Gmlt NL@U,3obtI>e̎i=xn}Ek}1:8%}6\W~!ye폯KKT uJhb/upG8}e jV ~C$ÕKPuAMk Ip6WW=މTZCpPܵRsrenYu 埈btq12CEe>Wtb >iPJ&fZp )*v+>)ӵLi |-}6~'/bg1]&*-N*Fgaт&![,PSgZz7D6-!iwCR 8pWk>i [7s($ZkF~{4r_}}EP~&c)D٠B G4F1n9Z&;pgt[0dIiʣ8p/).JK=\U}@7s^6> ;fͺyP016l9:W_dOag[hc]e )FngǶGVt _.jhm:ú@=PpeV:줙<`F? : | jDD ķdd^2[YɨC)l q^ IV H$uo'}z@$Gܞ~ɴEѣtm5ڹ OQ/ٍu4v*ybgu{(c'1#z}OӪqee*poY^^:L@@Nɻj$S%rk0 cjGHUSȂD35JS⑃b$f=&eIEќ^1G_i| d D\F&8KLdkz^hܘ|3UG.ْktAʕ/5k0p5s-"ڣxHK jE]Tzk7le{ A9^0v5q>p_ juƄ`l {OZ5(1& qA$'&sۜ'\ IrL' G*04fk?BI{I]gH:axɤsu@/$.VWN7:l<K+=R~' D(ӍTYH~췐~/()wo}Q%n6`3=EFXK>]pA@q e:1[x!eKV:^)e']Yy8rnOb_VcjC(v[+hZ QtÖS+E\*o_r& RGDXћU z'PO\b` r>_kŠSg X~\ g$[. 7Ѝx}8"|%AM؆s/i81FZ{ [[&!>NR,9vR6L29|r@v FJMÓPo fɈ;[&;%W9ҋN>3(z@Vz!5㮗Ff$:/-2:k;oK-(+QN)Jz eCNE6%Ohq >^N0t6?_I"`|t~=A) \HفdIh {)_^ϟ(baAcK 7URxņJx-Mw,B60&GMT 7n-wc[fcUJwJ(-rt.#KU9SqGV!omNuwK7VoKFrIiݐd(Uxh5ҰbtMYyH*[3_)P 0E\ W\nr>NrTY 91刉_'<2EdI7|0> m[E$Vt@3I5n6K=΀q?yò`(2dN\ <&@TN;/̓IEvN%ٖ괆~aƫ&t<:~$޽n1=nj#.%3p@Y4qf=qI +6~L-X!F@k)kT @"Ē@"uh?ф?3 +XQLD^ S<rnV KA*0Lo͒͡CD[1g& ]˒n,kZO# ;!Ī90%㦘C4> orÎYHTs/.0|!ryaղ}km: ٔe3SwL-QFSǭtWO@ Qa܉d- i)&⾣+*cAEL~/-W]*t/¡)Fok-ВT*dۃQa?$%LÊZk)Fzz9Lb8OBݱ4dx0;؜9\n}ƽ^x@-V)w2`)x^??wuRV ۍ zT1=(BOLŒbQ6*ՆcDV|/Smhp>fXpLOa&ퟰW%ӄ6v>[{21H- 7N͂s_ 2-^aT93sz2C(mzڇU2X'q+j^3sgb(]v/' A0QnèhX«Vc]iwK:- %0 } j0bHX( fٺ ~n*Bҥ%?f'͠I2pi`=e+1FG9r SFq28ↇM0rG[!`;= i Ѥ&kBD\vkAfpWԶSy{oGx+;6R/s+Z|UkO12Nlῒ REy(AD$k$1wIܜ %`iÁ"જ^Щֶc5"UZ«4A8Sؘ)%wPZN1*G&xT01hu;;k̲*aUQҒ_6 @]!q*<@ ‰- X5~Q뽻J>0nr3v27 [^M25=tAm%]EGpYI,*XaVY=v̵ilWm#!R6 " Vi!kSk̀OׇgB] k(EIoUݡ9󖬎*dt%jNIHeϙwcHy\ UF&m&O]`i47Ћ*X*FV5t.Ny`ǛȞ}sz@iҵ׮} Z9a|$aD?~;DԻ #reAՅ4{W]>M(L @ӗ%T:(nJsN^AaҘYH'O| C#'%tAPfIGI-X\/Di+d+^Cic oƸÁX75 ;`]^@#a.PAmg\\h&N ;jzW!B+l6ȔǟQnˡTe=fwܥA]!8dlHP-A':X>X>;~Mc̥KoZqMV -Lp>] )f|`A_bVn] GVҫ}UꨍEoow% {Hϐ` g)awdjK,Y܇|fA$5ݪkX>7د_ +*a/rv _<े741q0 Q_ z@;B/Oe Y~8=^%Q0W JIa7]O"T".UFٱU3[gFg{^yh܉k0 Lhwnt藊w4+@>?JS4UĄHQڀ1. {3c^1ŞEg̞[;mj2jrJ uv+{tKg8D&(:h1{4KxLQS^>{Sol~ Ν)Sl`:?+ ?؊@#(pPӀCb лG{%ӝjf!PA(܂| x%@K~)  RZӮZyD䌂IT( ¨yʬh戒tď( %S}'=hZVc3@ZVM V*5&z'QHhQ$ BQ= dwYZ1}kJkFNsMeAEVVnIk` pء]%5=W'<]qb B8av3lc0oh)LJ lBzaDNZ$ɒ:'ʰzd_z[j.f=G3~#bG^}o5ꪟ5[a0]OxKz|ㅟALU^p yg%_ٽ l9(O\ u.oO 0BsBVs\oưGxn%RoY0N / R{LW\$2 tYTq?HMx=]W&+^Xkk!X>:qƼHilP)IF!l:&m½q\@:\buۉ4YLk #:2R?**:q3\{T(ܪ`ppr|flVXVHwci5o,Шc$/'#;V];/zUn]oh/K@|D,?C/uy@zsFJ'.°r"Ā?3?sT}te7ajzg"X@W| .51ڔ,LH `~}~ܖJPSwXӚ8JleD]'PO@@F~F8+*%U氯Yho[.Faj (i?Dce?xuƓɛ/Mͦu/)2=tUn+G,tq$ڜg@O|tKHͫ_uEKZƼ@gMcknjJg fDnx6xC}x0vE^):}akg/QKnE Mpš.hqR& .\n8|GD!܃)˻_Aܵt163\<#lj>8,mꮪGwt$dr Bo2-S\I7.p9$ @݄,1gkMGvɟ_#Wa`c$@N,$Wjgp_Pl nedFUf^KuSVC=#7T `ՋN1Iq'ō {*.*Lƭ!#0}R})!;5K,P0gP9;; ЯJ!(7 H>hC=cfC^}MƖDX#͆`$$+ZTieY+]ܡ2nɿwP+Dp홢D V/g_{Hh%|,aEpI5/ɑ4.K({s*eNDqb3Ɋ{T,ƢD+%n?Px?~Ll`HqXȦh9H绠$קRaF|qu#Ow5Yx?FƊ^KM dM/ꂗ}ǵt@-xI(>=Vh-Sl#9|s"qqRA]X2E4~6kwyiNIg0_."[A1V۲\&L59anvT$+^<=6b_y*qH84޲OoK^ #y]gZ7w#2(q+ioGHHV?Q '7;_4™>|j-vʚl=̎t@1͂b p#8<pޞGUxw[W" '?&)ۯd]""uFL0P5xU{jglq_סrݎ 7^LaU[5bjf?Ux6I+'QZV((?[<; YJ_Xz ,`?X?&q |2/\,If(ɻ}Z-s/w(s @pP.p)J4R`aX]%N=&;r)>ҿչE }~Ob@-CǼ]XVQ SK s`Ɩ[ۚFO#DOF l]658 \g5f]dtk˼X*Z mVdM9jы]vp2[TsΆc&v۬l F*PO` KXz9d?+,H9"_liߝ%y94ѓܚ/SLEIMozCfU)qhP;C|V-#il}>`sdL*`1.$16d~DŽmx 4>Q'ܝW Fd2XE0>ցZKZ)-hw_9p]Kp9'lyrn 4Kpq%tϚ,I̻\~4,~z(Mw|kg!..&ztD\n)~᜵3=1wBePF+e?aawfI؎{kadt"lc& w¥K{wСlٖiPN: hJ܋`D@|]uO֖kɩدbiTmAo@0 YXM{2d4~ΤIipB{|^y9r8 ?ud80ݞ ^불 ,gX; KN/ aw$|3-eD4os._:j vPk3B~h5|Q.)_LY6X l]feIBJ[['Dc}SN/Hw[uX ~ҍrɒ>B|6qpY2!I@#@X;JI9:;t:UT'W"4r^ܴճpI[DDhy,+д`*ͦRY=b/-SD?;[HX['V 3O3*Q.M w3 gE }S`qWCِ)ʶ3W$hK:2h!'M@ܻY<_d8&t6&:~嶩)ߪLÖFEc$ƪ2_%N%0--6paekTʆzv|I7t UM^8옚%+}ak<hY=GqbS̈́s NX4T[@D% $o Neo֬ysӡIFB mW;fkH v.HXŧE/3O!# K9 oU'n8 P?Qir6ˋ96)9Tg/ ,(лν҉aT-t?{ y"5H٪BNWR9P^ZJRԓN^:%4﬑V"&hpteҊv\ Q0$;*Qt^V.{(yTLEP (j>cצ w5-pl;@p@ z,yuax$3]~&"y{30OW2Xr1zH3nzo]p=D)AM`vp4gm WzUgH1*(#%B&qi-L߱"*c뱯Bv;Fs=kHJ !bao Vo1U\Qs;hRGArXJ%&`82AODX]qE] qIewo.H3_XK= ̞͂^=/u0mC9|>~~G\M !g;""GuW<IM|ebqJSKEF1:8FXŲ)Yyl9FS5vOdMay)X9&bmT+ _W#Cݝiehn P@i =< j@mqlf.S|DI0d&cUVPjgQ]4EhP(6;68" Ʉyu>i~_7,A*/"9)#An:".ho_R 8j}txd'$eIkMOLKnwkOR~ '/Gfuw3AʓkE+|r_OJL6?I|3=ΖuvXEb; &ȉw!M:`& 4ƱS$& )kSW VзDR,&|xBk3LJU3IN! a YmOfT굢Q9:E qPͮ,ov1~yh,q}|,+Z{}15^Zc=ȳfHAY`5Ƕ6Kn[?/J( )JLeVDXn;`Ou;ǰf?.)~i3u 7͔Ly$or]H siY@B˱ickf3@17%Hr1Ͼ ޑ\q} K:ЪpˋhuE # W: 躁\~؜38}<8I~,C|F +5Z>_sEvBT.e"ZM0\O5( Wohj.m$!Fi&qcA#p>܌j쭪NM/8%ZrG&䳮I:¶@~ðhQ_Ƽ6kf>r╋+6k)k߽>͝Ӷ__70pp$F.`WevˮfwJa,col9'n{׹w)`4kiՏkt0ZmMm0{@ h0(Νfmo= v2-:]h+4״$kVl=_GdxI8 9'tQq/,DtWW.Uiy\s2yHH瘀 KO,v21j+L*WN9]MIa!!vZ`󴴏SAaaCFJh")!"GK VʫEHa2z #E[>88#orst6@X(ZJW,mWdUV_LaU;j+5K/4$\QB?0TF!Z}B6)N:[2 |Pą}｛[lRrJ}P_eT8ѥq"WB̫TKPpc%^E;l1"M81N@Ϻ##Gdr }'( <. 4ٙvrK[WVdS V{,w0^k&yA̡AO|U>$FWdu}XQYDՊב,O1LgR#B6?Iޟc3V0mLr@9McFTR"_ \|&e7y\~JFgN{w' 1rc^˃(*S5C 9'MJS^R>rUɼ]!.#OioAKx0%myL'"AC.x1_L&o eBH! RRC,WEIxH0RNOw aSSvj&"5bF+j; Ö@>Dy k2ς'SR&?h<)tQKnW>}XWgn۩5m|jpDu 7EKFG@RY+#jo1\ۏb=1@ x}Oxt-zբ)?drG zvP}\pڔ{hg5\١Ta3 ^J_h="E$<Ʊ:NNVkdmGGj+KReXfNPE镓4d& 2*jHɺYkngEo^t PBi?KLq1H%Y}?\m& PETs7lw2c_UnHUM=%>Aq:kvg&weOSBQuȫj8̔ )B,rx3It<8;-Ƹ^CكK?lPN|UNF8-̞ڊj(Xʕhk%1bJˮTl zGc6vi' J6ok."³OZ]n,:kIĤ9J ̷rZ] Lոkyw#4ݕザ5l6.gDԒAxtbw4_P~ 5zaAZwE'Xa|Zr%‡#?a|l}w=&7M]Sc1]_r\6ɶ m~_`׏֬6M;Y^mMih8#/*s1^Zp[e{kGzy5ۦ2L@ed4mVmN8n鍷 !WyV 9֑=ݎ tFJuOSۋ̏V2a6\^M6@#OX)XfFCZ2 k.c TP_lV1Dg&[ ] ie z)練h6܂ӪGT~ˡ(Da1ҬG ~\& {{mpc -('<aD kckFPØe)6֪х Œ Lw$'cxMTrQȄ^bsx,Q'uҎ&i*<}'_WO9(!ab݅A܈E>`p kMmp@Tl6ȝk,Skmτ8tѪb7ڽ>Vh7noZ9v˓z>hͻMH<*cDDrKsP>rI7؍uAlE|M~NFM ;xpg|]&a7s BX-7=5%g 8)8W@ k*C}IsA{~2*I.b#@Y4dz)nKK-KӴަ6tg ae1,0,JM2E$'\%?GH^2 49D<Ȉi6 47n͕,ЧC*VW+ &9~ B2 [ʶ1d`[b4!L"PlBlaJ{ELs%BB+#I;HqpZΙmJQ(dI<rNP  o+-zud2Pw? v$ p-w޺o#+嬴«JVAWjꖲ?3k%пSAu2aM^ Q2ڲnj9#,ҏ|K`֭{H ( Uc[t24I/Qrڋ:zrD-Z$׵dP8h,B = bt!u1hAa@ŻdJ8StKq̦n+uuhX[RdMi,Vج@!vXEH6N:Dq]&4*F̙9`M5՘žwH !Gΰ yQI-ءRf4 1I!SxI%d^@ulnnv:t#B jv oԸv;a}\FIV nUۍ|N> $](& ԝFgyvDCA Fu hZڑm# ?LMFI}mŠĥEbLa^k #p0|AnΙ|l)[ UpnxUF ,B4?:။¡p~ghmMmT lt>y/GPƬᆧ:8ΗV3V;ZB: Q.ef_?i0Z/)1ԺpC;~AZSK)=%H<[c]%8FD#(8JE|GWB~Yîx{{_geݣGe'#D9C3;c&8G5Q7DEi8Zq=o&@-iM`Owo΅aLQPiHJac Ctv.R2 رE}Q$^*瞉ծ_ g@Taئmeb^R#K%v֏s,ϸ.4=9>Jz@"28q(Huō+h |4"lKV(3zl5Y9okR]aq\U)k򵴘g@yWqTn#'a-y-~ >^ tq_bR nvopݪ{G\HGŧSU 'gY=>nQOa[ۑF|qYxЂ80'~b &j M̓g@j=ܧ5lfؐ αd{blU|T 9'WLi#;މ L3QwiPl=F.V"qζ-V7/4JƸT,`a~qv+|`?NL{p|u:P +'1XjܺҳПeuiEWwbsWu=6tȈ1q0p[_%3RV𠄀e 7?\v;_5:گH6 /+B6kTR-|d.қR=3]E2(KyPbн &`LO 7kwP -2V،a0$l_R 齧,CǗsHNEeB݈b^Q0o\+wH&!q 1{/WW{ MDC{Ic0`[5mœ@[$3C fHT6BIosJokwJUpo,*)`jPjeLZ0.$;e6+)=x=c@eʩ:%z}uFCjNwxĥ@8*N|@%bХꦟr9MAAhl[*QhhȈOwoEsq)9-hA/<4!1oEDG'E~Ciwߌ1'Dڢ/3˓qO7׭|>IY`cՄ \{$[f9384ܬ|}ɞ4* AIEٕ?7E/K uqғ}(Pr-P m7 5yBo%ڒe% Pv~4`2d= ZF[تͣVcZHRC۬masu2 ,<$5PiT9aE] +>7B ]1F6fB<[Eاrdt3_94 #)jil:2BQGw1Ev_qt*#(\-]޼%V\ݿ2.Wzfi8$>3HL7acV.P^+#W 1*1!GLidD7YTC0!&WF,\O1n>"Ul|8 ¶*|pۓD%y 5&,X=H ai}ojM5Si)>8\IeK'+q׋Q ta_6l;S]hG?gYYiB2<7Z)t~qE顙H|6:unimA},LMnJ/͑Oܻ_Cr/+zQ("xGr!R;#s)ýrE^?Wcnj.DD 4b]x;W:rb |3nqү AzL /  vm4&xPRJ̻͌7|mbBjfdgm٭bYh쑋$)t )·}E%w-ve81So8TbjIU|M;1]pnN?N]Vg/01stQ7u}^8bE7=ps0lH5mY[tD%PWCB K.< [?5 -3(I;_$/$8l'Bsn#aZ@R͔dڭcy?nG3zscLd[nH`M;'Oa{.QG7TjMq|oW;ıuFd0.T]A>{f T4 1ށG Bix4dkL:k[HcuKw&6<`~ Z1B&,fZHp9k;2V%o7t3ݶ:lsg6a [BY}KVՃ*^/6W GّjX(33^%9qͲ>y.1]ӣH dѦmMCRann{7d[8CXNꟼ9 h/V>ycLZ^-ah/B-N7qݤl0}W's r) $_d:~ҬyǮϣ+蛝%h}XS4DdgV`8[5'0`0@|\ ;73 8q⪙G %3[?+|' M!"M0'6)ƿSJCk ;#ӺpEРA=cOTC?aivSH#ZU@gxc{uf]V!’?Y2"\g?,ԆHzeTTP 1F A˸銐6.\3o`iRT3dυ *iGjtڳ 3,'Tg<:& $@0ᄑm+h3wv@+:[mHb!!Íp<[D⺴BG!Rf"t!EߝP<Ь<և 1rz.>s"JrA'Ҋ)Wu:%R=pAGd\D7nZbVtkzU%sLd?/O">bIY dL_{eL݈DtE!4@ggt/O>y[ϭhHԟ5Zk)gLo^G2s[ ƒ{ȯ8Y2lS  51Ģ9UZ `yQ)Fa'fYgo_o5X"w^Dt9/o kro–к<3"IV|E7ʹ:(OX}Ԉ2Ȑ˓:,v4*^Uu UXQZjvylsGse.ʷX鴛i[=jΥP,_&*Yz8^< !@@~@G!SE>A^rWW'>霍1FW4):*$W[هHB]䏸s<- ԋWzgk:&X7> pa50K@Kr݊끉vlV?M/xQ179Ivj0/'y*oZ8' z]υ8@R3TG]7'mv1˦(xL&Ұ]9%*`_/Mr@\ZJஹ0atP ;@(͝--T-(QiYQ rU DDYj|XQBpr-z#''m=WGU3~j qS}Ri}^@'bCp0JuEs}Ad@qnR8H$i6[*;hlr%; AM0M:AVeOmZ}1$s?kw#2䦔dUm@꽄JA#4qFg)pYB-G'`bE'AJ҅X yČmL@yI)9ڻk⭦{a - TF wUKN$CSw*>9ϯYY>'G#Uʊ%GLCHwS]aYŬSX iQ 8Z.Bȿf,1,Ё3bAGBWqu/A#$4牡#׫vkntr^-]5j"k.=5;êsO4 c= 1ssIQ[V8FxPHnjPy[~Cxp{Bt-50p)#NNK6bj%>Y\xi;A1*A=C3E(52:$tBynj|x7Q).QG$UX+anX@#U<6 R8s$wmus$ltlyU[F-K k,X>_A0y֣~]w hГHpmhw! B4 DaC]")Ԛ4?Ta7){!+ yN>N+xop~ +2ٔ3G!_[d@ŃV9vtS=1Ԭ~#PĦ&Nwkzs6AuLj~sNi%2DB$⿲f o4ĀB0Tg3PJkkBzzN%R6_r2Z )D.H,,㧍*x٠j L)+li?Xo@ ^jG&i =7`+wz9\?My2K_hK|5 PZZ|MK~1u]Qh)1P%#!OP.%(My!ԁʍ [6M{NP$/zyO"8 f+h؍,t_LZr416e!J/~[,oEdzN(EB5)ǾS~y5^8d&2ÞGysRk`K#v e+eK)-)DmVK\ϥJN|fEjl;yQ [,=#=#Nz #aLoE~P4KJVGx(TV\@Z/:#=u@=q_=y{}eU/ʎrvLZnZkNmZB'QaY+)d)zv4*a9bCkK c[7bW[ټ}h',w?`׮iԁEMdLJ$vyjs1WߏMqr1=A1.20$֖D)ݷˑiA.ʶR@(~>)&]`p_7NŇq6}kZV{fJlV Eebed\,SM%L8664~}R ɫ?2L04IՋwlN9. AA7"ltfL b@+7pS Ss+:?}48 5}a!5"}}aX@/oN PӲK&C@?W[Cu?MSVL{.2NE]\ Ir+=AC(uvBL{/C*}4ow?+Xq\]%f6n`+W͌ڍ<ׇ>TػsFb C1~J>2Y/K.n03򼙆x^* A1rM;jHD{ $/VL)M K;S}Y(D' nVMhE[\m^Au6C}໪$});9dQ5Ȟ*@#iTȾ ˮ-2HRd_-z%IoTPVA. U#|Ty jnA[P"R٬RHN̚ab(ے[ ry?HhN8'F1oc]ʳ)nG#Dᴀ f"ũr1"I^ ]5o!h=0\͚3qY\IW}8 q\iB<@-5De\vЬ/ҭ `z,%b4#|"Nd?Y{[~Pk#ä~J< 75ƔtU-;D DI8]Իp*GMkᯪ!EK#Ub}`,ap @ViF:V r텮,1#Zvu:iۨHdCgLAйݿ"R`4@cu>];rawS`&MMD ΀" KθR6_4ck:$1PĻ~Uu`\W`j3NQCm 8s,[ a@^vJAx(l7* (+M Ͽ-:%VG[&uO, 2;\H_:w],IQ5" |~+rB\ܚf!7_xnf.u3tPEִ #.uJ7nW({ӟi+1^/SHtLJm˸ Ŀ5#ӂzyo2띬<\ZgK\|ieܣ: Kq8eӞ85uCRlxvڸBy.{ڂ;FРJs`ZG|ʼ>G&|dB(-ensB+|(2֠W$:K7>HCʈe  z2]ٔ9v5 u4Ccɜ88>.* nQf YEd“u?:YH2ЊLj^VA]AJ?ҲolkedjnP xQX({.ԃ&$_~D%M)Сu)U 5#~76"l'SyWނ^_#eO3RLn#׬WT&̧  @Ԫ1gtCDpn_!KTİ&r{HLjrp״K1W&"Ҳ~俶b\SwPa8OEkƦaLTR_HrlVm,;'&B$76Hs75QyxKJjq/V{sQlqu=0EK\n;.@Ê-]Ceϩ`$zT(t('?’ZHRwEEĔ-P=x/^*\P" ͭl}*h-CJM@WL9c :}ˏ?Fb0XmdtDNqR ` KreE3}5:k$@+؄G* ]NwG)5850{'g=V"NDr+ R>HD*^'KgQ?3X5-*37| e) a% R>5,Z#1 W@HyY(`g*)L Z y o${,(J>D8Ĭގ?M!;ɝ֝j$w+N6SR.*(wuבk}E'ȹ(O*6~4[,uGr䔍ؖ_<z21EU2X$bORc $^1{4e-DopՑЄ*Zo{7]=F@HIq9]w`g$jpokˈnn߱JZRZ~Nua՘tAמI{=̚aƙyԨE/QE} \XbE}>O]U2I􈚙|?z.ׯc!$C2zGK{ c˘h9@b t1TRg"Adδ;$r6"t`K*X -HC! ä~*Ⱥ_]M-AR=>Ȃr}]Ke9@:|jƑ 'o}5VsJS:"pCz?[ʲたυJSƄ}mQ.7q6bZ-^fvbGY'yP6|WKGaU 9QրÚ."<~0!<4.jݣۮhǦlc+%cȟ>e/֏#̔x0<%tҭӶ^-`= '<C)d|~m+԰Q_km" }2N_7#SڱO*TRw"<58V\ e] BYрdtxʦ@ZoowjOxꈜV݈>E1#NyHgE\$ACÎß w㋠wL@ z!BBv4γVṠ `#eٶ.ɘ-@r]m-lF d~uH.T\zy?Wc<<is +_LX&g;8dOhcKTQ:_۱N)M`7XAtSX$)UIX;^r_1ޡL+w|Bp|5GcX6Dx YE }Q }~wF>y =uf,$M84TOv}o єOr ,>xp0%VtmzX If+M埤L6hܓQX_!JVxqlEr"4 ̋9w!=8G8I_RAQ wi?6vstb"Ħ M w|:"Ed}Oަ)^,ϛO '{hcLGxB޲(W2cΝSd2$Zz,ކY;M]uZk8%" D~-$>gδ U+ ;FЉk'6L9U~z-λ\b$3Q3<6*e p"UhWY Wڴ= @>6#iTJ¥nEN'Asuɧl 0nyVZT٬ 7(Xb΄W+\H L>SzӾ)W }`GI˝0#Zh /{ `8: H 57U|H{;Ն:Kښ 70Н H9|(!JB8^I",)+I*z?Fry|WUe[*,s#6 =!ӌ+JBɃUd  EA`)$ ,,A%3W2 zkMx w,0D: y]6Zp"ꝄnӕS&GPn+{3fn;2n̪?Ɋa/9 Cd=R~vN[\.L/{hn,]XlM# 8rEw"U} 07NA-hsJ}b,UjF\mցLȺC0(:MUVUƎLI'iŽ^?D4)#R3CEm^J( 5~GoTt:6k(icc^9XMܪu< S %6UM',:&0uRo./kGD#ayA^|gf=vUG.pOŇ'h NX} p?;(,6&ջ mm?|90=Y]pn/{qɚUwM90tj9T;(ҭ C$װݝ7@>"*zGZ0_>fU9pu8)7w?MZfQ2se.,^‡ ڒ<z l ]xfTvON)~¬J ) ( #FBB FoW"708%:?T%%}WP4H Uh/{Yw,ض[L[kPHE.CMZ@3 )hS $;ꬍV',7Dmևh5"+s,5L#SSOP+R952= ȄA KٴAo6;Qpb!l OVdpioC/XiI֦~].ݍhe؍`CqIǗOr+B=`=itGځ\Q1<Ï~5{ÏiqwR$,8uޮ;FJDHK= Ϛ=pcZ+Y\Qa ^fc}]~ z&jP١$gɔNf*+P\.竺({7:/u`ZqM܈4eYK췛Atf.2y/._zQa `T4b-1[s+*N8mxMdDl|i]4߇yڵHFx_2'v-b@j/Q/bRyH@+s ŶˤZ;/>bCZͮnV1/]o=騝Z9|l9Յ<8:z= Nx{9kl HRť 8r-Rrk܁LICEƝs=CC{9y3 FڭxHWr7ŝffe'[eڅZv/N7&Jii6^뤥nw:-s V#Dr@^yDwjaMQy:菽.7$nqˉzVْ@ܰ5oI-H J |"ޭR-iNmلWHg1|fYN(˳>胒Lsow Ҝ}6%fT2D_m+Y,5#𒩈kHdirVɊc`#űck ~~~UǓofV{P?PftAZWߦtUV R"RǓTךo:_:|>"U-.[lIFC>DGsyN*qFkT _&ZN9H- `I8V\,it½z>rlpQg1 'HU򌉥9S.|!ɕ[6qٽq`G;wۃ1[aW.š+5)Ӈ`8cVL\(e[ |4R8/PDrCW:f+N'¥)%XUqfB>kH)Ac~n NuTU\E3#%!f5'DZu䲸>T)\29>˖g7:Y*,W{O:6QTD˪fQ'21 }3lf%'Q[[F (< ~ڌSYe2e Y WaR[By:dq̰7Y/?~1(//…_e<R1?rAd5[r$c<t9=Hb2)QpI7ߚ.y{7|+{e2Ѐν1CBVp6u]5ЌXThyp\! goxl@@`a"X^I3"n+.m O[ [[̸78O`@EHYE>5r1/ yO-=IL'&ZT}w(T5q'{j*#cej3qB&%͘Ы CTpDy c{ԙd !FMԨ?sx>ޙS:fM=lv _3ZotaSB<*V A`8B{(d/pjeƪpPW"j;Ef'$/C[faQ?%k]%)+olN繗t +x̨G**8zkqU ;KL'fEE|%o RaM[Y4w>n!%@\FGOL1IoşcMfu^ [R j 5硟&|aw%!;X%T!#Ck'qnjƾh͈ fu['Kx0v7jOu؞w+<UJnfTcߵ#ni%Zw;Z|>n:ܴi B&lA/>;JB[k8<_q8Hb<o pvNGs>hш4cI㟋l6Ԭ yk} V =iU3|*Z& b8 ~e.k( zJ}bh}ma_L,Tj)hYg6Ă_]'AX^p2-6]ܧ u Ofjh%eF\we|? 0]e giA dIq͌PO gG`ʽє1tazh ynv:R$KNX)mm[Zf=CJPBIVsǹ4'2z9[W_3N -}i yd-[fL,2u?!!yo"@D$ 1yo0c z",%)HHPuP: 5tEODP!˝",K`I)KC]g_Xc HԙǛpB&(h}N>/ A<=s6k0˺5IpoJ33^""<Ӑ}m f)Z.<-/b3?VS K7:]7p<# V74ӭyQ{Y5EAprPa^.Xf+آu;LGtAC{o?[,6GMБ7k9*fߌuɳ10hh62)p=غ[ MߊeؾsXHB[VҒmiI&C櫖m sF;?1_~0 fof.#? O F񡫌DD;ǥ2o@^*|&+RIRٶ\2̩"ڛsc>]Y_ vf^lOU % d' ?wvosk!z|2Y(տȂ x֪B Z߅:j,ة*r#2}-NlR${UL %F_R~FXG&QLɜsPi"ds/f/ h#LQ5󍩵;ywsʾdnJX|aBcρޗch w*AXtL>D5Y^e FԦ*Ն8Ժae+ϣu.0>,(Ov֜7\";ŷd  yև"tƅgsJAc_G*< 7ٝJ*cz'<3&x]1۳_qm״׫*Bv{?,O("$U^B Udz uK8I'09Qס7Bs2ks!jQ3"xjry^/_*I`f5mN6{?o+Uf*c:; X27)aLBVqMMBlJXtz8ؙ߃6)咦# W5q7DPx)foŒ~!(]a|*|"&@"̜K2v 5;.Ǟ0^NlaykSYUۍ6JFO9$ 55ëH2q_*|LN_;`LO- qJv?zT -U'OIK/:ipM3x X|qc:_|0kl<|eB$ k !BaRo4bI? 0C/Kt.VY%Lێʳ1|X0jcxrږ% _(f_; _q #wÕUȱ˝Z(":OIk"= R꧚wK~hsjOL*!g!bNq#eACK)kâwSs5Ɗ }w jli.j+Dt|v{#a vHi+TCˋLֱˁ:XKQ@S1Di,`MFϸo`q TS FߕzQ G,J ݙI[JZTM{H/}d6)]uoQxN{?G=Xwkɋ8$@%!HT/Tm pTm* 3^7SdžɻH"}'ũd̟]4>Ly)k?uQ(:!Veh/V\i*Vх,"̥vu*jwYL) XolˮmprZr3C6y@"qt5%-ds+xf8~ D%?䬞wvVzr8rrDe鬈b,F)փKvQX'^@3d6|Cm?7m!/Y9 F-){tHm(F)$`^&/|.E`I6UʅJIF!;dώuWU#O(U^rL di aϯIӺl%v">BxyZr_ ۂ\/oE7E$mjSliD \vyu߭8KA'+Udl7ׯy*8sM(@]3lSVܨ!J5_JҰ.aPwEK dKqilTT2nKlX0Lb4<{쑙u;Wdˠ٠:-{E%$t% 8B8JQLx=2hMVB^j\%``wdP ܓ@=C84wۡR'^a xO4RT=_VX# lpo G~!IĦkӢ[d5=s%h!d@x#jP$c dG=JvAyS#r14j{ߚd$:XƆpbO UW%:VKHh׸Eg`ΉkJظަd0j#dfM}Y/`ISyT ıoU !'hT1 ;56i95ynpdF#ϫ1-& %dH6Bѿkz/ {⺾/"8%G6zFrwyJQ/ΰ tl x-=QbІf"{ʂoY&Im @ZB /p@Sj 8秤zzݒ@CPp; ]ٔ#>>m>( @=݇!MXyntްeLˤUXMEZŘY|XQP>O˸X-o|$yS)"lQK(9@W:I9U濓všpB}替&Qr!I9O o3Ҕ/.9աapĔɃ tkx*1rhG,Z} 0A(%w)JOso[o1wU/A%Aqr'ú68E^n!MC4h_8o#Pe?H/OV_@G,vS:) 5X8ZnWҀI5)z\E9,$Q0x!#ڥXH@+W@]+9 wqf&9+qY{)(Jiu3|bc?G,-d"b gXW Ed n!ܠ!m8]Q,N,@X1.#}Ph5[Z ms^/ k%=cYsT&܏3mŲҷ_=gAp$Ndć"7;bum6k R iZjPyͽlp|5=GTȃCNdRAϸt5 J_3!rQ Jy;d8r^4YjfRsZьjK+ymL͇*A3t[ro8)k- f/v 6Cų3SBuy@SY'97Uc*}p[,+|xԗWu2˔Ӧ`iNֹP =BS4Ԭ{Go!NdK-9}5hiB G]/L=9LAG'4EH)^=YYUJ&6Qrm/8(}mr,Ps=!,.r%:ɣ7()R% H|qi#Ph!$Rǧ@eRK_XԔ!;HGHmyERVJ1Hb~+}l[%P51*Lx з[.+}K n}h@_̐,-p3po%H?No[4& +,IgR٠l:^ןҿ[y__tu-3ZWr!'A`/%{Fp+J:.**\#cѝcJ)dPNm벹9vi54ѶU$Ldv@PJW\TvF tnG)!M2˥#-T҄xM0c Q,jfA?1,Lk̙LgflCx%Fs_`~5/)P/sFWg=31;gla-_Ew"dy'lliݧg2#Z4|GC68{qRAфb^H;k\8L5-S+jY U0_S+6_!5F "zt2.l%qK|3Iv7U{d7?5gVKSw ٻS|0IXSTvBl?2BZ TBE3ej**ӉX'%8`BVDw5K6chG IscuN_mȪ}HSJAiʋVly▭_G*  Vvtj'b>> o'},(PVqg4T5e F N"tqHgsF>rKr]xmR+N~âV0!2dptJ:RP57APgbԌLz=@IWmHO>>Ӧny }| #DӪR?5f_55ӌs!=ζiu3vy5SStw}gLz=mDmDG hPqeFs< Կehq &CJ6۶IQm=}  i>Y_0+ yάqZпET,^P0\8 l^ZExM@ ی>VHn3J:jZJHG'݂1|oiwm˯#4*Vs Q Ã(Q#B#}@765}QY*Izm6g{h|۴C K T/n#/y,uV027{c/#ʢ1^Bjb~3U{5vq #͡E_RҜo[hmTX{]"gLnta_x:>tUxW~질]&Y#{枊ɡ?5*?B0W!t_wwl4ć&qʸ1F!ĉ|/ 54r/T{):^)!^Qu_HVMt=KUC_#8ω47'n_d"h.^@ }סD t7ľGgF7H*`ƓriJCEKN0keQ{rπ'c c}AI҅Л#ڸ륜v#\uo{*NF$Bncplь.ei M&R\N̘!.̧=}nM7`z+B!Ŗwݤarj)k oT ܵDX/m[APANܟfQ{lƖJG< 9, _?1?Zx=XWA0j Ͼ)~!&c1 9)ҵ99\P3} ӂlPLq\ÉVɟ1_ r>,4?(ba\F:W(K!nnEvz faߗy0MSXN\&t^!%. )jqE iգ?Ws'pHlz{8 8$md!s CSl]$C;8%>CǍ^H鹙uQF_!ߟY¬],@u?pFذX&&r'7E<#,p+>՗ qЎmI5ۭb!ĉajX-n`=蟧LYcQof絓p2~~LA~^r(ﷲQ) Iؗ>dfl /swAP7X)n)F\o~ òj\?Y``&(rdlAk5k=WNwTS$皎 足95Ƴۋ)|$ M4GO?l}}bӃFO Y}3$Ewǩ<H_42Y:=l.8S{0+.z/lӪ}zRW\;b"|L:] Ck3HӮ݁f}vZngmsY.A?A"boQJYu*Ehp)3j@z-]`&={M QWTE"9c5h!/˂'`y, rc6k?@H¢V%&g!0 .g_COCZ8/prZİSjS) j;љ;"5a_^ǝFe9JK4HF"GSi,SJ1Y[?ZZy"?LI5Yc,2h顈'24EYgGOuh!Us^nޥcbQ6x?1 ݀WOO'VLAbeBT)G^ٞYiʅ$owpBƱ%(U~AlĺL)vz۬*Mn2&0:&x6n=TA˔b 9]&"sH5 %G6 EBlŲZ6zc~@X1 nv~K. Q`?C8;ʐfbݨ0Kt Q%$L>h%WJToa'Ż~sq ۊ NB^J[#'Z%+*}䮻H 6 /q˖I.h3?j ,|VH_TK\xzް:?clURR4bزUBm>0Pݿ HJɤ|`=f0]pNN{Wɿ jcbC h_!n c%|F|=%NSr}W;O.`&N4>:}ףݙ;oClJ: y\%6CVyzia)'D6ˇ 0o^OVEWK4[ %'a$X}stVIDv&~JEt'le|o`l(0uPWEfCGc&Yť9YGYГLZysB{#(rGM 7{o%/PQB{dQm,e e{ֹjy㏉T(]FN" 2i2)k)h)6 ~VIiRF̢j1! ad^.8v4wƉ !ʄY6 j DXq02xes& f7|zgIh sĪ揙Gպ](+&ǔ~'/#< .߃Sumv8RSIoyY("zۨZy(v@HDl2kz2Auo0ECZ>FWO+@; Svq.K5VPVEʂ *pUC-ԁV(U!A}mUpx9K^k!.d '0,i|S=BW؉XȜC&ܒl Z7izP1-}y{6ơ'B6{)D0 ex&cPq#uc,;ce xm=uD#x?l6V#'|m{N-Ocw9? ʩD;;Md? /)s,[>k|MKNYtLPQ5I}Gf\p]u68[^_.#s-L/zq_Kc_D'קq_@,q@$^׍E'p+FXI_7f^ HQH@NnH' Tq(EhtX %>%EŁ).[t3Xq>Oء$2%]bM cl @/r!}OJ|fRB;;*J=HPnԪ,] h`6qu92Ec!X^xSK[*vޔ4FkcBGf?H`V2 AUemQyUiT >"9c?[xF5 Rxq.Dd9|p>J3K+:)fXA;:ݯ=rWO6$$y&MϿ|kb߭7&'N2(6dN5Cc֫ Lj:­`Ns:>sq lTw-)y/Ǣ좜34q0ڑ<;n'bZ!`_^{`mSvXL$ݻa9CvOnB)be^].NJKX/d8<#=MWzhL԰F1!]v*}Z$"Nֱ3?CjFuWi1KG9<}7_u(#`/?o:!R'%%'cY cBlE;ydR`3F 0# n D;gz&\1@ +ªywFgF)REދ3as7akJJ' l^s}^I3F: 4BD0X$$m%"D!eј:|9,sޣ|k]$x,_Jj(0 [ mڻOa VMU$Wrn 5{{^ >n2x[ڐSU=;yRDڇN.6I1˦g]H,@SnQ.]~ , [xv՝{9`Z³EfQ΄1QdՉ"5Ȋ{zQ\Fh?ہ܊ o0L≖Dh]#4ŰZ7qTq{{j5e*:_fv7CMʞ}tI @!7>V2/nu2SP =w*By?`Hx <*;C -U(?)BW6ضбUcmU6)̋yࣻcfr|㫯C-fI,}+:]s”cҗuĠG"L  9خ\=QM KM˓!WgmM(H˳ 0ILr^;퍖{=XiJIOTU.՟Da !HID.Pby)#Tw>yII!y}ҾU/awVp2a88'ySZ hְoqz?EÇL?22 0#8Stgr)䶼:q欽-DI~29RhomZOW SF…*YU8X(YpcwUwkʼ~Mc",4視袣'`&/cNxJ9bhࠪbH+d.׮u> I{ߏ7X,XRrsf`Ō4MJeUk@JU=[B|#ȥK7]L1 Gl1d^NL{BR j=ĂBc8`ܰ:2-;ˑ}#)wRo_{PAVx#ُن&/9 /"yCfGL6P!U&:.| +Bheu[RZ%Zqt)~YW Ĭr8qS8*#Uݎ&zGNTb4mi rŜ^+!2lߖR,ӨznT޾1Ql/I>(2& g-0az{E;A+_D٤UHY:H{~B/g,0+~ S¦(ݣ=)mEmQ0H;Q-.~Wuu5]!NhM_`{E`CZaU@k|@g0z>$ .%yu) (E^ *k8=u6O~ەC,u=@'8)I~A汯Lm8RMR ܎X 4GF? Anǃw>hjhod1q7"vvbJϰ/ݹ3pL)u v\. 2SJ{oy0G xD I!J-$X{Z_] )XE[^dC4GY]'אJFn8Smv&]NlmEs-Bz [4qM抮FixEQMOs{ESgYW-u6-WDǨ>ըs-! &VJ٨^2aqbebv}piG)xz^FIS-ˡNE;٦GFXSz*l2tS2v==l7$Ȭ $ւ®bpAk_ʻl-mvǠ˩PF% >m[li:)D#7BttǞLh\s]v²Iմޮ`Zed?G  *Ž!I:gs&D|ӡnf$[BEI,17 ?T69vp,3tCC72p- B_1Rz-wAcb֒];kȪKĮ_mĘk'Ut-]r:r^;J Ec"v2v _q*A0u篢wxz}W!!PGi&t*ki!azhWkV2 p0ƄtvF;`U\0DƉe]Q=I(wm˸{U#09J ^]m 5'Y]L:+Xt7*Rjt 7 ]ḯscDwd~M-  3{<'{/hHaR^Ȕug\'gJ;"j*dy+(.`J*¾_y-~uxk?yAe2"rNus[~~tvscxPE/[KM6 [a/BUm_|M;#j?;3az AM ͸ZQgH;ՓᥙfMxO{\~*?i|Ye J5h4lZD5213˞/@jϰ.߬@KˀWm :9ZY"jyxM+ƴrZR1, p0)sHq \FYowI!C W`MO΋m_/ztP. 5xX{X_I3EYJN"t*~ELFB|"@DF _(=A>Л.M4x!{nݬ˿"U*oQ#Ogo_RTD==aY4ZTۋeоF\D֝Oqdl>(l"5{cEoagYǠ$,j/]6Βx'Z,uԛŸIHmu1?Vn O9?'Sȗr1Spd09R] Q\+}˰Y,&l" zD/cY0rS ih!78{~J GJ8Dt+#j3 } _a]8MW7B3bG5h'xTYv.X.0k[領~VUQZ#e`KJ1XWm޺ nO5c?#@qW=Ԫ]FBkNś$]p )E%p7SǮvUU+V\[ 8EKhfz\/}Ql!W q\{Yd-}g.#^Q5+"La`n0$\ GS!?R|7t@ |EAӠN P[4li^=)!:ݽ!j?ck ]eTh;X%?k$Z9 Cm`)e?S/*cw?8G1犵 q 51 τVՉhWd5<=deMoPtR뻿:oj= Qc{fjqH%LzCC3TpUS٣>f|GE1{0w2^T!Qc h+,dcvۤ淨pJ:+&JU۔Ni$:hםlutBe`(鿱j XnS̆v$L-W2L C zڛ ZTJW~elgmUq*x}gg2hY&{`g~AP^Fb}&#=%A` ߲u6 eԌ:I(7= _\(g'?DVV;'h圓SV+ Y21mZ]ͥ_!iMK3fJSN75tw~İqO%&) M/bHd~B Z#@amoUBWF pСTM?;p~RAoZع \MHs!vaD_.'(7+lCL)Hdzi!}r[7ʙwv[{׋ ݽ *{w.S $dm2~C4a&!?[]Wn&(lυ#4\!Ä g#`$P1mg (@vMa*'θeG_r-cy@Ը;է"gpL ]5E~?CzLLIښ^LYbw#Akn\f`$WH|[qH/tZBZkX؏#܉$ rtgK{LXIt(, %ͅTq"̬\ĵ-^@?T|2qeT޽|B0TՑVz iHy)|bgҳ7Y]Z_Jw#Yzp[ 8%m[EC!}Hfn) ZyuUxI %1"*B)~uIAZEV?ȝfѲ#^.f' v&X0.i[ohWзziST9 ܼ A}7ۛ>*ϧJ#&6FK(cv??mL,>Yi# r@t @gb@;Y*{:-!ׁ 2X9;ީtm@LAVI#q@h-d#?LscOW( h3nr] rhG7 -Y/hmsi{p^Ԃ 1E= ׃WJ, v41.9Dwt^8s?8fHP0ڐ6+j@-^o/9_3?다bQz%HvD`3XJ Sm[bJ*{D4[E9,eA_CJܝ!]#Z%t5G_v C'5#,2wJ("/j bA/٨&ZXw 1ݺNuOgq-NPk`_D4@]Ir"tϋʏzٮtw_Nm >)xt`w¯n\}'4Z|wFa׼Tg.-Ww G Ӟ7˭ہDLŹ(Ǣ}. c!h]:H4ؙ $_"6c Rf&[cƜCLTw:e?Ya PcN1^g anr~]x cI|ve&үg}nU%_sfߥI~ ̓ąT0jv ^xeA$&{f ̄&YNyv[3Ҵggh}Nʍs:dr2'vxu22Q$"5fI1gǟw4>o. 8!„0.lSbҭ>Htň֯{NAX ӭ y_LXϷC,%ᖊX@|[-Do +0 Όw;YS>_'[o4 ÕbS_--xr8ޟ⧳;ZCtkA-`Z=/]3C1#Fז~ɺo :HT, RA 50dJK2@lI$R}ss 9@Nc.C4-W˰a(mՑĀK/w6cY}m~̰.|9Ԥ/%hg^̽B8=]]yuΦΐ%[R~cf_BQd}y8?ǎzs] du0&S[X[x4y8unsGyGfk~轸.,)%wg}^R6&UBkO,Dk&gK?VYCL[*@;`*"5A\QgƼ q"9>_3L|}ۻ`kV0AB~4Qy~hnlD#N`YXTETJ8$[EgOG\fK6i&wJM Ü,Dp,UkvuDl[tP[9&cK0Yz4`u*[da"`.깼[un4-D =sFћDX[}j,DA{T>!JٗKx5MAYmsy/"A# "Z?or8hȾ(FU;ɆfZoBVFӕV֊Dp7OUSaIn3C.g -V@hM=$Dt|.ehM[5Hr _zR [je+ 1?,a֢p".I砝B9߯@7= v}<)jĀxrgXJЉbn>Q}X AxCY>i/C_(mzo\Kq r?pBF 6TJQl.!J5F;4^BvK;㼬!rC\/\&Vܜd4̶JOzγ6@xkp`F6P]7u3Zrϭ˭ O4f^ǿ=½]p{#qFw?LuP \"^ dYU6.<-6>xf#}ْ,Utr'K&΂![_`c?PBo HzUEQ,ꭳ/gvBƒ{,b*-pbaQ+.[59NC_*xi5 %TPmYAf܏ZYў 9XNs xqȋsA.lxL~,q|= vz>c:q܈cve^WZ3$ح^B Ih1ϫ?vBk%}X+6 >df,pPƃFCTM. ͻ"8\K)6.+`XFӫ!qm? eo^Yutҍ{]~=ݚ?`lK% [oJž̄",BJlĂ>}n[ah|rzjLl5| o/':1Žjz}nk@ we N|>zO߃ =FOu/rd6xLN,* PͬXgn{@&J;QK%jŸo8X/ }tY-V?Ax*Mk%S5UOBM*p6Ȇ,ZF-y?/&֕f.Ի0~4m;OD)'|+!i^۪h%~$6ծGbX ^,UOA9[AR1~t,f>WXMgs}F;d9Hx!.%l+V|BUW7n 8 k=dć]iy StZ1Zz@cʓYe֏F5f1e"_58u/S)w {* 0 VUʧv7 'B=pZM+jD=1&퇪~θ>wo'LHvc ";x:R9*Oײ|8[:9), K HyE C4^4b)biT F~72P>1fױ\>H :,7P꘼ЧF :u8r!+l^+z/[;'k?+\"f~ ?e5۞I5Ic{>ot"E\ F*WLH;d}ѷ*vZjZ1Vg/w=~("O@m7;2`nm6tM[;i <Qlڊ/۽Zp[SҠӒFaِ5S1=3{ ]:2K"ČU٬5殜!oA+aB%s%?#H4r+QKY4w!LUF_ͩG(o~uK"%EE#ӱ7D2`ammc9=bj#c6]OQ蔱HGGܝF+k;wqF.X U4dGdh0b6Xݨ"E(ak`ea \A? 09c*R7ʈd]M *Zm9BIGPfV}WҬ4Fe w%(b"J[k)I]Hq/?&hP=C0r1>])&dF8{;S= l:#U;ᅮ\uQ:Ax?NGOVR Giz=YKξxL+U [dr [k>l!@1&{ܡ(.|nHy 2ji'% RUޠq--j)#ϸxG]y–5|+k(HkI-}GMeZV%lex(n+.Y 0̆QQƮ=<,&-N{ENl RLGf3W O qLauSwfkkrO] zn-ܽHoȲ8' vyGeݹJ/cP BIDɿ믔d䤵#]֝=˱z ԱP!$e x v ݙAL&duQ<ރ珑S* ũ$ ae*QZn?ʑd9Av2Iɹ#wf:@U|aUݭsh&c</sdSeodY$Ue;Cl6A*L*cq#]2lt=0ڬkgr/$ +L)bbw ݙVmϨ,<ۢuPѢy~mh>! =zoGFNo}zbɫʐrȤB(^b$NV)A6YBzO Jjs~M 7ϡ$5&Uu^ns`(fIO;qD`4!C}"b*Ҟ{HY &В ڀL0$r~ ByG'sjǜvj& Szsi`Ez0X{2jq.ⶢa5q[ج. vOz:oi̢pM$Ư8 `R;Y ;,t 6H:Vb t0^$\Gܪ(%XJ'0?t]r//U.d^cHP8;2>B knqzHݱ l_h5(jAP:PALgMp\jlI;*4Qrϓr.[dxh-ַc=h w]+)ϕ^w}֍- G)aq;D!8C&5拕)lQ_W/;8%벐T<0-S\e;Y^A^ 5瀖K`,ompMsP~ ;\Ķ_ 'NNH+P=\ Y8m^a!!+C3w)T  78BRkvqފOl' |N# u#KSg&;cICH}7H_3LB# 3G#*C;+Q.R5[p ؒ/9XNHჅ΅>xUT5ֈ?\t2NCz@ӭ+vkJAe+87[,g9?̭S"x`酜WE# GuNt*/O*4䢛P8F$]:QЖz,T װy$|?mMD wVIF-,ţ͉ )Cv*ƃW&cxd[(R_/uW9,y9^SaDrqӝ: 1AõJEX @0XjQOkr7rY0+غ3&GY`02XꝆl]wI;_shTwB(sHכ=Jh5П R\ZA C}c&E{ |c<X!ܦ#[$25vwZ{VE_-{.;vF%*N*K3MG`:E)SW'$(tE\"|>MΠ:Yo +lu 0Gy<foBq>%V@I.ff8ة*>W@P5$Y0FمU c;P/5:c 5nh|ya:RasPHnय़n 4 (F!~=9qDX[\CQ##$@to7Mg=]$ 帘!`ΞFiog/ɯ#-^ ˙ Vcl}WMT7j[jã.UMg4{͠gvPL /y+ӊI ]Mf2VgmH'o]VUv^_ *2 ̓&DBo=kQzf:Ȭc3N E[ Ykf;2",4,׊ӈBHF쨒M|Ge:⨛ `UI@2tkҬ3`6×9Y#;d6(`\GtTݦY<! ~Ƣ;UTN6;$hZH(ӳwn%gZ|ȸLCՐ5iB(Pl`?Z_,;?|ui.hBXwa>N< t:17JG4NCД7<4IhڗgktX8Q_T^.}(E5xrE[,L9ţ&S8)?\SaWTJ<;W"UD111 hz/]7u[>giEs]L:՞ZwY|m$9(ؖǬ826_9VRR~6 y;jov泴r>Aw֨!_c ًj%ATicF-RfTپ s_a]zGmp`cGyхD"p܌Hndyd܁m|%t~D{t)(B1跥-Mbu.xy}_v*9LkEȟ\_[][vi£xdyB[(<f0畇?zYj ;9m&P0Gp!8g8@-xp^!VċJ!ttEUض"g\]]H.;O:FfTLVKeb[K1e7Efss y鑢fפk:04]=a5(2HdCG!$K\C^q}h+ݿgDei=mK2'(~Rq6SZ7^lIw"(UW{]o*˰_GCDάq BD^t0hT!=:y"2}WDQ_3|My0>qdA0^2-qPw'eu$|BOl.=y Va/0ui `SoWptoXk-Ӭ,m $M롥V>Աא bY,nևP7Pjvgg[@)EV=%puY4eW@w m:U^Qp0;(vPpI蔋- qo8~gԘ0/Ot$Fp}}OgN=WB1UqRS/Rv \Z62T_`^UE*!VP/ڍdU Pot,VA642oQ"{Zn5Bt^aAw}Ҟ$h [1NN.߶Y^KNZ-H;$2t3~i ^̈́$>Ye\='uW R|+;)j &Ұliĥ0n㏰0W?sW,]@7BHo{}ՂPļG+)%Ǹ{>Zӭxl]¢2Q;/.:ɘ7(u8^*y @*X#֋6 I &ѰE`)CsX/ 7=qťZ'"=ux}`5L@+z|0dz- S6+($E']@GDi@aXpN˝X/X~kݖ&Tlq)HԠh.^]C cn'Wɾf Ew@J]8>[o|¨|̏J8.B?t}zc2E2TN%f"ǥ_z&q!gqnO4{b㚮9{I,3E0&Jq 9m0'茞+GC3887uyd+畟\ߏܜVF{z!?jxkiPB3XLJ/k q繬w释CEMNPIhyVXRRn`MaZktH];[Cp Cףt:H0%ǵPtk'w7 BmSxcٻH5a!2:e mtY/k (0P\MɆu;G䗃=7LV:w@t`zYl< 2{7\E} Oo3E96?6$wf ؚWH`~ 6Mix\XQhHI̓O" %.<U2[ +b\.k uՎ G"D xս.%S <5{ 5 0!2/ ݚw9>"Eu-[]usPvzG~\FiS Uqt<`QrUzbhoPO ZןW`?Osx/[ Ń!f ׂTǐ^ǎG6m"3{W%ĤDy"V/ a5+Od4]Lz,&$4Oo*v޹0D.9O1ѝz͕יPY#g'?L+6^֭7=(5ܟzG!b ѠIJ?>)E=^|0wMHsnѪzn5j0xC^:xb@Fl=مL ~qt?%vv4Rƴ1B yx!g19uQX`SJ[q.$ >9WI4N Is>SSWV?^LvsRBZl$_ealmYQӇ1Gb 1D^#`h\mMӾ5 j_='I|iwq*x`4}F?@2?kBO6iB]gĤ`;*T)$@FBpf]4_'n/0nb<9ZqMKA8N.ƥEom3I?Սbrԇμ)h7džP7 %_%R` *Cw½5| O9[zK@.)Ex_w-*Xx8F6IM/[\467<) -f\DowJ}:ų%lOp(q:Yw%o)z|8s£&9U/Q7 FC1"9ቜ~q-.oS%98бSNmV)XEnzy^ԭ{c*o}9h{T;"(:h3n7  Uʮ„ <5а u a}|B/t4Ŗ#'1nNxoCZYͭ Q I o'*3_ ZÆ?AW5 #+ fד !{ΰ$4A>5q2^ͧ):2 S*x 9 ah9Cm.Q7c$iv疄UJ bA" +ep-1tG!;KlA<:Uct8ZVuMFrQlC.SߨԈ"MG\JLaI)Tr#,;GDbN5$#XHn14Нd-D*̛CdڕxKڦLRO%D~Qoc밑Ʊ'2}7f/!8cv E>=Mk0KQ޼5=6 a|0ydSAkv1.*>|uW .t Z}A#8w}5'qpq:;A9F&UJІҟs:e\E?Gzp޲JUe.*BǯqVS3=J/0u/+0vR6ʨ.lQyP5$II f:dUR^ռ5.]kJ[&RdOKy5Rqo>wcNS  1)zr_i n-?NEٟ}$HV۾o2|B\W")҄tKZ5F"mW>^ OƋ^ϴ,ם;[$m_kIԣςy4mT\͠LRABaHDb ]bb1xj˚)FJO}1~C$a; 񱲔HᲜJdw]v7 $N;Fm"kp9ëVBz-[eVVa1dP;ԭ'5d1_{ ܨ]:~0C ʤV5c {C*ðRmчקYVgx=[q_ ٝCkOD77h¦n[y@6:bxa,rg3ӛ"ZCXWJ2"PWʍ:Ňn"E8% >Y:Oz# ')wPZJ^!3lq `]DAR6w@J*;ԩY@p\kq0>3[?yOFE)9+XGp]Q֠0@ b%tsؾ^mko3;FBh})` 4g`VKfrL*l*@4GhHH:g>_p6K ܇ b*oeh7R@tpnF/z ɋĦ8!VFL b7f_"`Ty6oc*FnB?7!&4t[뻵bQ.1n]"$flcuG/L #E):OQs+&Vb(/g\'Gbv ٫emt`1 ZY/,gMQ+0$>֧R˼.âZby۠Ua'[2(BgI΃ւau_ylL_NdLym8ioc6,_xtT-TGx=zzˌVxP_Mv9 O$`Q$P-|FK%!iSt+& Af0JS]~԰As!ÐeWb3eE~rCV(W+4\4a o1J|5VǵoP*Tf$۸\'Iu_#0 L V\E\qkƙ{  +<{f hbl%v[]6Fխ8af:V /O̳K=cA$2'(dwOYm;: ?_]Ykۖ)qAۏ9iǙ]қ9' -& vOx 2=>ru"XF"Jw2,/AQc!9}&*.lJCFYr_JΠ9VsO_=;dG כ>L| PY./̫CQ˩Y2 wF7r:t.ʾ PLBUkVf ReJzvXOg( 䉣 ?F".Ŕ1L:K8TIz`%gٯ IN8H6G4,<6xG+ P=tߊI%źz^Z 'T@zҡ!mu}l_@Y艼@eށO\գ4s>M&b,tmk^c \خϼ]!ccHJ2;|u.9"[AGuS2e˴A3*i҄u jV-ք¤}y,XTIG~ ̸5*Rr hu`Na6k|2W׳$ˤ!LntWg;@Jlr]g-.%+@"6ұnQ `tFM0x> f2L;ttڒuJвAy$rbdeu@RۢzNV6'D|X+g[c;bT)Ts=LW7'%X尚%6g\G4?xkx~m2B p/߫gUy>Rc@ÅCn6{XјQS)hP|r\~ʩ-OM8T}A_HMHn8F/XBx#K[3XVFl?9fx(40τgZ D%3@rR;Cp? 爗 Taa1$CG.Peh ,ʟlxvcojG\a1+|;dZ>u%Ѿp@FTFk7l6c9 qR;rGB uDƂk M*+ozɱ_WZ( \˷eJKc`q>fG)xT_j]ծ-mmb.hϻhɌN+, e 23r\ 7ÁAS|tk@Lx?B֥Qף']/RgJ΅أ|߀=dE @K;XH{Zdxlx4i!83iB2I~9 lj;$8(WrB^q>XhK9"SgrR1MȂډa{*M顫|<@ p؇au5y﫥{^`"cmF3ŶGc[Ո+1΢= /b²/}Y0zն2HvGM<|`JX푾$KZw4$xw2TWDU4ƾ!Qhd51ɲ1hvw` O!J&;\g}tbc{*ΖM]?{j,M[;3! ~ҨmOj&p,!/;ܬt|۔תc,PBc1w n룿+B1A I+qxhQ[ٜMS[X8Ri~IH07"WjUFO44TB9m)ï:SBA{ =bs `(!<>*fa]&@Iy/5k)n0Z_+sv(+2~]v! JQLdryw'34`sl9:ߴWٙT'¯%+ÙS+@yY9>;['z{<¬nD hՑk%1(CWF sռscEŘ P4/@F,ث ]ze%+q.? &#])?d;IcLR|LqwN8A} ̑JR+8YX˧4aMw)Y5ceuMxo %oW?w?  +,^IWH1&X1Tm 75JP)Dٽ 5/$7 B='UI;*k$Wv*v j`8,g˺ake-rm9Uu߱-E*&R s kzV1")BxRx= qBX;u-=*l88[$dn\^>CdG[78*&z">[絉m`ߝzy7O.g:.i\3Ntҩ6J[EڃΙd@b-z~ϺX[r܆yDZ u( [{ΒB ,f6ySpH/T4nAfޑ-4'`~a:_mn?)0 , cLnh*̠ 8""+†k.c1D_F'M WԒc 938UDiԆ|AB܀^m›[6[Y_$lmHilIc A~)B_j0گt;*K vR7]dNPJ\G:8@K}e۠{$ tl,oG,n=-%9eӴKxUfz;Y1Cf1ɸIEBG!;uC7ZKYapT\w$՗(=5@<-8̒K.%_O$&5wE"z*N:y|1*/ ]72;+(ثJ.% =W#yt0ϲè[$r9̷%.կ<7 = ,m\SNd SUh<hK dzK$gnxBf[Cc]Mʄeq?:_mv-1ZH*/AO/C: *>J1 _~)ʐ dcڞ$B;7*N!Cw` hwD ϶JUScRV:9:z;B՘oEREK9^2Dqqh *N[5EX*g"%"`eO3DY;!3Yuf7KvB#+r|Q鉡3'MEq5G7 tMVJO(!a|٨eɗ$j@-.AGf+B3˘-<<}Ҕ/E!"Xx7笭)bϬpiY2vRE5Rt1*؊d[,6mq72wʒ$؂ ]:R2`^Kg`#vRv[Jw0HT_ڌ䜃mm/ :'e`ژAL9J5ԓ/w[;'r|_I`+~ 7xyүL'|x{C_c1Pȧ\$?PeFY{hЗ%mwμ=C\Klk^֍%!8sC] 4t67(vEӎ ƽ1P S2\v.N"ޗ(|>=osI^+ziR_N\LaHR n}lyi26ԼQݻ#W;9h$XQيƳ2J_y\uZߊD $;^ ?ʴ茝alO2%կ<#LPmvcs;~vp,SŸAs*7JZ+gv||MD*X; *6KB;7o*-?ZkXǺZ $_ˁMPf@g¯ԶZ.#gltgے9)bYLU [/+84@,h[lB4I~ bɯWOb*G_nmza=r6w $Fr<" qG ?teH(3٣Z4?Fd mt꿉iO!b=6Vd$U:e֡-ިžiVɢH7'!lrqP6g(+R^ Y%ef_޳RY^/\(xC?vkos Gh>YF:/*KEdSǧsA{+Δ_hťL?=硏ଲo_CFeXP;%M6qx\a "4S8!6gdL]~p>q1hÿ\gWo4.ԽnR|"nkm1 Qʩ0c0_(*Pm0 c˹xPrҹ<Գ-~dɫ# Ц|q~ ,YWٯ#Oϳ^X'H<6`rjcE]rCQ,,BX~\J8EMY+_^0]1X=t\7W'[NՍ:oa&t8 v 8#QQNJBn"!Wљci`NCkS}S(|[HB/)ʰy5!ٞE@| Æ%kcb&OsE)(g]p;#@H`ptN^ZWgV J^ʋ^ ں=ٖ']8!i$Ax&4%|^8̅x" _ Z!iGKXuƣ(8%~o\ AhrqUݭ7"[#enU:jKԤ 6'Irۜ')}3hj4.ay{jȉӡ Hx?S5+w!.;nTuTT.S6)+|Nw#,\H; LYɾE+ nYE'xn1}ҠV؜IDۚ^?dfjz{"M(@O죕~t 4V+7I'x>Z }3/DHYz 4E\WNMqR=bZ͆zkQʶ cgc E`/1]7[|9/)ck_QN4!^d7>q4aiLY vFADBV^fLgZInQdZEږtb0EAS A>gsBL~M;Ǯ+,$tu {ARIJ,׸%&d鱗9hwߟ !<d)@Fa##ګݾc?7kBhNr2Ad@i.yBr uv:/;xlN9OpEZ'|V],wH6ͩfJ "0'Eo2Wݼ38̀ʄ";(e W/g9}P~"~Wl`@^hZpCx̩dݓ9ϳQ}AVf K1Y_#]sA=C^(@iӞe1/$ *ݏ@0(cX=QǏReɨk ZHib4n(Px@/1,jHe+I2y)u|)!ݟ2_QQ֤zyS6WC=a__ȉONuvTxiy:!(ɏ&n A17,wUý xl v8WhZ=uf;EFQ)%G8~Ynf酘pֽ;(tOk0A"FY֞y\n=M$j΀p_T,0|Cf.8SBf7'o"%YsaoO5.-v-`3w}kP:X`ng'EG rurDpzzkz}+)ڋAkeڭ3~-ø7f՛ӽ\eNH>XEgIgΥyU\2!Ʈ6>ꘇ.o6{>h)/'5ƬfiTc>T٧I ް?Tx] >66'z|Řo0',P^2T!c͙lT'H==jv&fE ee4v|GFj,ҖESȝ8JFpkx~],B^4 dcUs@Cڌw %߱I+f5ҹEp_AI 2$d薐9$ɓk"V! ~:KB8;W{mMsjβU?;N33so͙hd\鳵IDv NJfUԴ?ެC̒Gki`6OSy&Q\ w`c6ML`αxpM>둓0!E 'W!wLxRv<~6a W&N&/a96I(KvU7OÈqK;ʣ[}m,'Kɜ2d#gݕ6N[d^ 3`$/sݏv}yP/Lp^GLߙNq;n8K.ey0ݜX40k &xM(X=ISNM;F" uwal|H0 xEf 88Ļw7#خ$랄˘r#CmV'ž#J"#2>dxbH*ab.qA.B%kU#˛-;;Y"qA0J- cX;AXMJBgnT.7fH0B i3 zbUTIK{F7cI}[Qkq-UTٷ67&xDݝozfWxTȏ.z#]p$DIҺq)&[/bQEz%f{x?D!ANvIϸ`b5 b<IЀmAU̝_VJq sule 5x/`vysGOĉ y C ݐ߃z N-}+v"e`+6۾|! Wbgj%Zfnz+gedϷY'C[Vuw6^)0Y۷&\iW؎ȥ%`i.HxVbXz?~*vD+c^Q%Dg'(D.i1dvLY/XRP.p2cz:{eUSܣrvn.\a|9ʠܥfbUe@=ϯ|3'>b .j")K'g^g7wrF\^{E ta?z`m^UF6ğ4w8 lDI+f)dEF4;+W8c0զ =ՋMN}b e_;{Sŷ"~u>Y"`@0dž^x zsIV=kאFO1S$%$<%=]+(o)VO;1紝P Ɩ疯PYė`7 .QlDK5w;Pڄ fr* l(iW^@7MvsumZ  ]@ͤHL`rCcJb"oؖT'NNpޥ]:LyFh~vC*Dk 6+nCrMG">"y RJȹ,,GL<9w^Z-fJ%Xm 5BO2ǺRZ;"9,p3b2vPk'bP@hhR%C YX?7_?e)韙&-X5HCgl'sOL^]B pbpjӓ  e^?&\ B@ )A{띂q8%滉='oQS.tG^'%/~yE[G(iR?넋IwZRx epό|'ׄzl;C~٪_+i|j_qun|H~(6"g FѺ;zӀՋ)HT0s@%k>߸1b6 hFX|IZ $i:JZ.y jZWq5.[cpe0o;rH( )L+94̧~[Q;׌P&-Qb|ahU.u'K3(i)~MMrjZ$UEUnXjL39$!-ᔵ>; zsxW1{o-MMvsE}aFkrvJ6 qg;خD~/RBuhY90cZ1Xp9Iz_U;uyƩ:+4+d : S^ AFWnXN*8NrVju)2a7ѧ0 ߂{-: ܣȹu&ͽ^!8z-=Ac^dv,Dg3Ǡ:1y~{+ʁW>nƛtm~TؼG?M1 ^Gj_Ws\|!e~1d.J9 V%F3QL!3Ϝy8hXݚzTdY 8|pұ}M;𼵓˾B*"u-k"^GnJ˸Iī=gXiI 7/Lޓ.tHL 7Uѻm9D4p;"_.Nf$RulP?MɅfK1MHѻ9e׌_{ҦDN?V0\TqVDf{k#!h"74辕}#%n]}H:Q+) ӈ" VfUgi'U`WXJ%k'LjXV܀bEZ9k p>2./7`{CmI#+[(\¢k4MiQШJDwSFz$Q2{iJ;A ۟L-xO|u6}k* E˥ȴlߨɦ(2u ZgtfyVuL~r(#;$+⺅|}0`/{&-Em SN0{G۠lTXEtA1e/P݋bJF[wv`˜?rU՝ <>+<IT/]ė1Wf'_Ϸ7i^h:IO|e I7M|s{l`7z\Z 8 qS/C-lk4F h~ ~a@nTUMɤ Mth5yKxG0OuvU2zׅCF(e5HŚ`^QYynDFzd_xsԤٛ?ƟPd~DR(j Uܷ<<fR@.7HCvp%)!<@_R) cFª~3ֿ 38qwiqѷ^h}s kVfr])S0m5j+]#cq.kK %&~D_+%cWG}m ]uTiϿ䖞q)}:xdr'jɍpUEuAWQJS̊ j/B?&ݚb{թ})$U\,-岔`Y1T+Y1TdKx ~]ۃ{ Hv6 Z'}`iN܈&]Y$#;;MqعdfK1z3ARpmަQ!OӨIK#^.E>C]|7MxmTm|#ՓN S1uS1X5)tuB#y ÊdtZK{w dSYahΜDip>H?*-Y,L>X'T=^,^ΐ!݁fj2ϸ:fYfs_lxj{T@6#m`ei׫K=J|̈́2 fCXZ$aykiO?dGB 찁6!'=FT0~#j0z72Þ^黹7VY#1oxД Iݟ-6Y=T'3b]R)''ۙ%_kNU\!s"^?JJyZ no<6+9^KsÐDԌF| οx+ʂToó&w~:`{]:sg#W6)Mh ܵ-6*/WtN! + x13i$!r$ U:ykQOBӒ̗52|-9Q"޺B~>~v㽺}Ex@jwLfY8;ܸ 3!)${zOD"T-^~ZK(oE\Q"RԚB ֟;?/%Z,0k.Bٯm H"kA@RN:wJa a$s88)ܓN2yU|NBF\[i!aa/$/SO-@4 ~yAK ީҨc3ɟE!d-lWJ K?7L*& %_:j aN@}]F.P .]P)鎱#=u Y|_Q1bsFAE G('R卐M|ځGG2OtdÙ,0_IM}UE0ݐ2DZaZrKCd1 UxC)*j"v.}[NdZ3fq>BtBu ! @7.A!NBܹ\rĤ&v#O~Ӓ*09OV'_o "jEEHHjoVPi|a̤ģ$ek* 6BbIsOg5D-P6mȲI~c U~ŷ#bd[M4T'jQaM0I횕$T5axaO`nsj=[i#!BjysK†ܪNer9VmpE&GVɰy8Uq\'kY{Ap w=^1uNc& 4qz6IrUDQTwg5es}&.Zũ-nblT3Jo/ľKJAfR W+JC$H'E̞»ܼ7-vF;v6U`_& ƀXL 8cYGnGGt}fd4S 8r (bH.hO;yOVJ-(0A߱scm~ʽ<ݣc] F}vok@4*.m2O6M~%WU(R:'Mᅞ[\r-f.wCuՅy_WfbZ{NyF6t `DNtŻZ Y(^p)I@rsXN'1J@޽Uն~C7fH!dK4,.pުE)ТMʄ12 COjҦm >S0&O5[e3u=[DdpߥRygk'SߜC ^B6u|t}K/Dpqfi.EG)zߣk+hyhkbxmT8Z4wwcȧh:j$85d|ptm&\P}-<,}*G[()?sëE 7ꃥѳ+.v۸wYˉ,vFw;U1h(֑%^F!A>S1/O& YӔ8GH(Dy.u;^nw8P嚇!Ϯ}P?Y@m ȓ\p*͠M!\򂄈ݖs \FĢt&/{s~ ^ ӡ`ϲeT.g f$l\\JGR.tV|W8UOtT۴@j1,k%0JQ_RvWek{A-zp8wH#0a*~pj&siK*K73*]~xafUqKDS_P|duI9)C}};|4Oh|& }AN&0AqL };WȵGh-ijnpjB]ӥðx+Z-V:cZeӥ ?׉\;r_(`BOv ,RU-_R>e9NX[9O2-̇kHw#u .jC+RԹ1brxjӚE=,3Yok7lj>SXGڻRv5ѐK0D?XAb8B9- l53@^.8Ո]NaNױ9!HZ,n!(JA4t->:.LaE/2i% S5ȕG;MoNj5T0y*.#@Uz_ dorM'Z.UIH"0.1]n)[Od/"LiuTHyOO&0.v<__6yvG93y]g<5#vfaE>!swGԴs`%B?Iq_uWS%Ylq:o7 a숝'26jXͮem wGAx9w*e5I!!5{?]@ ~jI(; OWÎ4x:'LRU?e\Ì+-!c%<cQ1Lt4o ՈS=6#8_7#5wX=ӫ=v[`j-Av"m eӋܖĬА3Y5^!bc 4 h&7] ܥuz[V܅2v%X#{CD"rsuEQ^%DĦ3*ߡ0PtNjܠ0 M %ytf[@T-B@:iuzeN '-KFܔItR22&7_o&@+& f20>sD&\_Aa2̌[T\'AR -0 `A=#p#:G:EXQ]ZOlxw%y:WJ5.hzթBn"E>AOy.{R9rc{7p"-W&yOB~Tu>eDgm[C#a#WXC [D6` ~Ĭ~URG6oUS>aҕ_gJ5[$Wok bb*uqVӢ].=+*@sq Grv870*ؘ!&):tc6&뗊Z& ݬ6^랮OC<ݻ6ۚ]4Enq/Bgy%=W߶$j!ábs!-u8JѪ! xw[((#`$Huaua!Nl@ _jxʏa邙qL5/ ;o~b,)EP4d{چΒr#T=P)pc]6ȞC%VPĠRy O<%"L5)P1I&s ^ݙc"U&( =H!luَKUC4= GR(/]XFjxWyX狡[XHnbFHVxWL3|βͺ%Xj3L.u(=.M%OeLU\%(T"Sb (W7S-)W`,RX zHJ@˚2!N6v @{YAJ.K|q.ȍe)8c Wh^3_Ɖ, bI7V5 " m WrHتd[cbfT|0㊣ ~ RE  m[a23y/TOxMu("78cCb=:RFRz9#Rrժ >2 7~9giXj5a,~|8QW\j#!chd@IΎmUҵY+z -dsK%m@Qn޳ @5iE>!gLk3e\ZSpyXȝk̪gI%h}uIQw"W^+k۩iw6H8>wYch]-l^Tkxp ?TiVZ ,BB,^L<Ӂ6k v!L/`0+UzldDj.ť"}jXuijf1D٠=4]c ܹCs|>`DFb2X{.h7#@-,́2>n̐S{*3]"ՄiG0cs3naBSEǍ$HyKDI|:Z)Bm=\BF|9IYOQO1܆c1_{]MAszit=c>جS5$e+m/zW.ւ0Sa].l=jO "mƯb;&}׸n"z:@vI͏Gv,lw O[MS=YLW0_#_."'dfZ0+\FĮ~L78F!6*K~Au7\1g[`FϿqz2?;) z(N}KtK |>m)s PԘę6vtдQ~scȢim${IS+>\*O_a]% K8RphG&v_I& `ࡗ 톯zV}HBt~ͥ@Tȯ1!diٰ)( H\GTNɻ`}b݀W2c1"}FuDLm2r%X ҪYvIİ0hz֟]fN˿ͤy 6Aċ/" MNskiV̓Ob)a Vo-&$ᒣv󂩛jgrz3S6 LmC*v׬ ^vl<*x)r-QNm5߷tB?7=PtO~} ?H!r|Ml8Je U5F$&_ JqCv[ 8|O_aIHs|0̨'A5nK(0J U$H 4x%9ƓؚKI (OnЪ{|w9{S r8~Na2zkokb^#cT~[7%xKJP.7dU" ͘nd ^{_6>ީOG9h TÚUuLU^oq/kuknyx{}k4S{"^YSKqe\DR˖,tG _dH5p?>_ȴ +V AdYZ2ˢ4n*g_w9E֏6?Zͪ0U%ً=馢@D0dKuAqTPF㼀٬A֮vPx,3 %Rr([_S6/w;?Jiq. h!oeq^͗[-r Hرyi E'ҹ"~,1鷲ӴW:q(yI39֊ ݍ/c7{d}9Wlh] 4[PO6TQ 0L7rj26eĪ ٦JI<ОX|{k/ݙ6TY}knL gVN<7ԝt 5Sig⦰fœau|Yg'I<0լ LMNҮN(t۝ȩB?oHfNIg6gdn խ4g}жz`wG[n8.Kc%f;+[lz05,NuJ j1}jq¨smvA)ӿC.'e 늙pݑBÇ14SS5.RMXP[㪮%iz*Noz;!ݰ΃|g=Yn-wʤ hjo.BMӲ$2s@kЁ#QHn?VSiPd҈+@m<=@ifg(705yhI=gRAkXFYa*JüY=Pltm/0v ,+$V rHv`ϲ 뭑V$3!A,lFFpgtŶ(SH*p̣kX"Ryc!*xG(iQFe3'l#J9ʧ d˟Jbx 2.Kp莓;J^+В2r/,tuX5>Rφ7%WU[)X)7znxui'E<ΣB؃΂XJ=tv.0i.Gqg-MY"7<Ғ)(조8K;14O>}nqb"$MJA]C%C´uӈ;ڐ8Mu:P}US1,NOgt E4+H`|Б,;) Eis'kpv mh4xVn\#<~@|+0JByfGU_opatY_5+dyXϐptU2y$Sۜ7˥P6a IER1s[YY`5wzncήx[c")MxA ]fak'hST)Lgy-ǔ "Z֞B .tB7Zkh<0Yu~2EHxdoG}s򷩩<"zveɉ:$/I8RӇ{;3"<#|aN޾3#&- &KBHKWFUxWdԇ߽]Q?lC'NXE\@R3y'E, ̤L:ihQxHGD,}n}aw_8@H{JS!mk3պׅ$1E\URXuBQ#BsX*oZ\C T߶G)ܫg+[tnzW;?ʆkv~@gDlٷ#Bk .5kV_ 쁎f1D`eXǰ2.b>nC>:V~J*",pib 7'Wv(&@j]o7eIqJFin>n [|K{&9нBM/}I| H*J*KLDM:5O}qN_׻3|ÀYjl3{h[v9(UiFYO{Iμv;d(ǙA.A#wZ'UzN~D=43XM0|5y]JywGǑ6dN2D lnpC#Í!aD' /uI: Tm@1:1r^O~Wdžn=^u8S8Aqs|RQ*Cq꼉f_r̊opu/:PŊ{,117p3,}?WwgXZZ{wQKR,7+ /S0O/|/sИF.嘚~&P\&̯f܈@e/tWnuN2%a5XYx55X{Hy}+juh߉dVO/ђNDtаn2ko~sa,4Mr>F([5%l_h9([!Z і#N_pCbnoݷP9K:P %1S $2V5(PPW38BA3;Qr ]s=(a6|0+L% ӝ N#< A2~S/4qI#GԽKޠ VuDɑ0:*ֲ1oa$\!V!b] 4}ԥVlMA3_ͳĸŃi9I4.H J(79q yҊ4e"2ɞǂu)E,kY&Ӈ=^{MhZCymFb0ʈXq! 8'nftC@ 2Y(8Wr B12Rû]ձm1ZcwF!@")U4俍(#Ϝ2ͿO٧{Z;T_Q^,%^}|*t~ 5q>+,Q FS^K0h˟"&:ߤTؕM,EJ i@h)_|#XAv<{RSs}Xz,70Gj; [&Haey0" 44Zq@0b1m9`,ev t=_ 5w64$f"*s3"2gkџf_[XXjkEZ?LUpuu"#2`sM>_gUЄ{t c4jq*1ѧE9oDѝVbYwU:}d (Ǭ8 SS2vš5H)(PUI0prˀIen:0>?ᨽD0P;a67nA L m٪7in|^;)/0Jfq!&WD#q2H0É0=&B_Y^Ih#U<}ԬORI!۶/ЙK7$j\E"Ϧ-ɊPW5Vk[V( 9_iG(H :_-lJcQ \^44wsujY V(.AXtKCBFi jd-8ٞzV.hŒ\Op;ȿm5l.%Xg?CZ﹠:0V#B,xM| 捲MhJQ|Ғy#iQpx/j_/ERyQ ǐƚ!YbHGuv9^uݛQf0$j mLw0KcVC=4U[WVŪaz2/yL9 ]dgFۦb3UMןΚ{6.0[ f:Y"(G|82h޴INBa `3k-rBȒ\:@ru% T--x@ V"ի(8亽逫 .Z|^!Ldq7U$ Ēv 39 ٮr1egBnjEBP^"8S]F-zyf(r}+ĵ!\\A[]hAj%ΘuK>:<Lp `x/ A*K^*ڋ*ܶXk6hD"ACƸ( Ehly ) H{&*F8m_#Wx2SX?"׊iqhw rKI[X}]=970ȃ,mQ47lԱŠM ;5^tU55s+Y?%1œH>xT-xcݡs rM蘭H_Rx Ш]Yr8 `򲯨?dY4-8D3K3J*0a#߶}=Ƈ9}cpN:R. &;! )?d[@V&:J2} o )< [QMөu@TsL0 {R` <$p@Sa(d>[U0>l*@ ZPw9N@ Cet!Spw_܇"(^$v$T'/6?kFQ)@{B躲ע?}G D-?2:QI`ܐ! },_"UHܧ *:q:چ(s,%'^mji0'ٵ"pf8n6JWGR,AK_atZ0l=T_]1|QL|61ֻF]j2:OI ?2t,b2ev^M7.ߍMRD&BH9;Qd`Ez>mWdpւl _3{:0,C| a6 =p w FqWm:JLx8w^pt0Pر8%s!)+v:Jw7ݰE{3v);{uG܆X;x[#ci-oxX:Qs0iMxI2Z`p795J6.Ak`м9y+_F*Y@鐰$Z3A'm1-K^kM7~)(! .ʰ7~69vvX?ڛ謋Ə>DzפVR5zQ5IF'8g#s4<+׈lM20϶Ϧw>R.c e݈cV}|'o݂-.P`7DzԗY:;y~p'HDC@ /l{,DXW?(Za A/&Ŧ\QrfO!HZ4}.n?4F'*=_tKP_-m :UrqvVz$))&]PuU~d>>g= Hlw*\޺Tq`$G,ڼ\EU`W³ (=7Jr<|~w$p}ҁa|/;k6h S,B(!H3ZnY&b, D>ꌵEb|:ɻW "a89Sc YضUW:tOq+PоlbQܾS-TT(*?0SGoz}}ދC ?t w7TUqH $?t0 )2B_Uf-`l ,= ;0?^.kq\ܖyyE85{SSBEB_hpb"W0w'7M5uO;H1jM8 c^w .m 7Vt>G#zΜb SUMsɳ.@rzT]$Ya]>sC 6uX `0uJͲ#ZWKat'wng?e4?`D Ч.NYnjv[cq<ӎ3x-yZ.Sej 5{"bϜmrIh|hԁV*M!=/!amP{fs՗*95rW5(H=9[\P!it|yvm< [ѝrvz4+ʥ=]b`Iw.N_CS݂1u=V3I22(%G)=ZLWu,twU _Ul~QȕIGV>ʀ$j K(%_19Daī`i8`zƟ>@%dF;zA'dD_<#3 @I5KL{Cq-BqW5< r;jmǖ튷}C/҂+fl @Կ$e5|ytSC,fȜgy5QFh7q$NlzӖB;oW:Z@oͷ%~UYSF)^{e8)%& Z2TPJ嶾o#~MW3oֲj^N$VWz{Kɂ /gHgv YKɧxAF}SQ-cݓ)"$ hD7.HHo9D](s o2?&g2v2K)kO){I67vGzv**>Rx~U]Yy8y.㮻eyd! rȲq^nSA&hcrai]!lau{FuUΫ #Nzmh g݀c('MSxWor.QF 0ZBPW\ k:,z>LHDQ*l%g]0T`QmBUO/o2_OT|'[_n^}o}}Õ o!5@Ո^<\> ozA + sڰi=^SD@s~ iK~3Sx{^l[?vqFN}r^:5qiFvxK-) |96+9(XC oQ $}!YƑ.-,K>\ cg<'"B3sRTc{{-i6ql|$ g2"Zs!oph'.T2#p.Z5k3s.OUtO8R j&e7͙s $ <cGfc ɷ4GTU5f20\Yo>[%1 ].\|9Be1C~^uIQE-:0󐋃1S*y~b66IJ!cyT^þoNs]BGu +E@wNTSJ&;GiC|O/ҳt"pɶ r2!]D.g3]{tn8bO`# qqs,&I&w }oXqQv}lUN,=&2l(wɛ`2Ǐ4Q.ia66?z̬H#ڶs1u4NT͋[4ȼ\D1A_ <SdՎLN|je00*~Gzsw cDKz(v1ܼ@0y΢ ($g.CN1L5MpB9;F&s DWch 3e~l-oj݃*I0Ls3|O(=Q!`>-ȠHL5NԀtX@ m;k3DnxwP)opK2 |mRקþ6JrM~@s[ՅXk]aj|"*!Wb&:p LJ!ʵJh#҈ugg<5{ݏ,次MQ^pzt[V5?Fp CmaˀA..ǒ/gE zA,=ꀯ2)rFG:2Z:ّOp WFlZS[7'eI"8/`ZS۹yGʈnɅ])2oƎv&,{Y<E K ,uzI:Gu6..(%cuQ1`N$lߪ;!`vMVK_C[I9&k3>?OOԫ:g`2'98,;KFW6 eI2(W o3* 9 }/5/фAܮٞ.0!~ȱ6͏Q{^PzG6Wl>^81\fFAW6sĶ& Q#<ñnp+i៘>c\d3fVwD}xˬ1/ %hTIhDIv?u;9 A\&kӖw7_q@jHoJH̃ޥD^U_&'!Z+kIRWs빢; mMdCyLdC3w1IuHfjrJ ͐$*kN$g5vE7D,.9j@,U1S*yQӚAYs]|e&h>UΘJ0kA] {yT?5bh)xA1-x""_]"ex\+'dgE <tCZd 14a2,k;*5; )Mrځ6fmڪOLapU(q d2 Ze\LfOy ( 69.VX.WS"t pqkxZ`d~RJ6Cfy bzH9M5tƊy8u=mrh)вkHGk/=52YX'*^9'z ^Lb) LNFh<θ`Krߣoslv\.ͩ|L82A9!aͥJ%>o`edVId~@q{p%zNS"rB[$t5/಼2qS܇*X@9SEjV?.$/|CjM ge0KmX $KGRə5AlqVy"n2J;nLQ:#lh*OU5ҁ,y*82` . l`w %=K~\V?鱠 B\Q;l1HzB~V>%ɣ|[ / \fϊ6\_&%$Df>G2Y}e غzH4DU54,Iܔ;VYi)\~-uDFNIԠ\|#ٮ[>PnAp!s. pv2!,a}|wGvՊHA3rh+Oڇ„뙟41&b9o;]R8ghwc5IJR,!\ ;0M C|uYԢ{nh3ό1BHgR ۠E;ӭL3VK:7#o!TuAieHЩI_jx鷖.<&Lg{_Anq2V/a5spn;X~T IEGOnBZG]wn:ݠ$Feu?UaM+f `κ=Lu;OU0S_#&|^{ ? @tTѵǬ0MѵЁrqf"Zoz}qLmcK L_EAZG̵jx!_:~sT+>׉́Plv3YzlށVNh\fG༾surU-rzBAW^Uք~: ]=6Zz:=;;;1? ʅ|ƅG]Д5I__2| 7AHˉ\_ \zA&1H$/|wt!ҵR`쒽8}Vn[w(Myh}x50 <>+n:]!L̋ɚJ+GaC< XaFx8%Pn^Q&J,,T^6P&Ǻ,* Hj:tԆ`Dz<eT@E5.(dV?wm+kx>]ZcQ#}KVGz:9yBTT1cؤԻe5TuS*ɧbȱ)hl3-(_#$}= Rf޶TKQؓEĖA)flKz$l.]"atWY_^(ulo~9OG&,|)-cgx:^Q)5|Fy"$o ,^ͤڜ-OLnG!|Tj ԴM̔$NwbÞ4eC.qzv*ޜ;%\@V9@%k얙>$R?.zw\'2TYy oo]9A7i?".{fbm91"D9>r6H>o\m(ըDL|q9>GɼeDo?1ܫa řVd ws![P@&ه_u3ًXcafxBx>ޣҪ& h&_)QeKcuTNk-q' 1DJAեZͤ>dQXx@)R3_DV1A4gȧ hOE"sϧ& B{}nV#滔*'/Tչh;_a7*=7ԯ6)ߓS@'i.#?9^KZ  \W[\] 4nmcRjk<柼jJ]tTP4#?@> A(X\5ӛ=~e);}WK4YO""M^^pg蹋mv*/oL((v"tv>B- 5xf(&%cPXzM`g~Kq*$c,>ĭ@',4T*Αa=3| |njpF Z7-HFC'',A% X%oJx!<ٔ >GW@Qy?4 A) A }dsw{+.hDEᐾ b@.wEV20;l1,&E6BZ璯@[XCG1%2fipՉ0y.K  8M8Lᙎ &Bh]P!4wx.PG"s01Xu#e(uWR|=f)w5b} W]Bբ-܃}2UGx=0Sʊ[ #;K'XR#F2a3kB7P4!ԍl2.+۶ (aH0|FbAf r7-]cjP9-ʯMDr,a6<īB>=9ܧn.#5aQvW9ŠJ4DϯNh("'Fl3E=s]O6B3c:|:csX;77y|ymml^~A(ve%wS;X)3U? U7F廢yOGDE5ˢryUib%Z/;S@T@*%'ÄqJϟN鉭y?t"NLz[ʧ<<0yu1g/G#s,HHl'N@S:r~2A7|~BR]Id_ 5D8Od%q=fN}j^2[Y<;ç1]|" v"P` \u* DV!$en9F`F,1s~dsyq(t_3$bUQwпf@M_[QU 0+ɝZѺa}^S2#ɪ_z9S08l$:#D/~tts>$5ﲌL̖=ޘ@FЈZ^`=3J? Py e+ECn2zձ8( l> u_Ft~' T_YeCŁf{Ceo(vba &φ"D5R2f@~j_ɂFlEn0PCl6/ H}aͺlk;ɌB0]*"4o5!_9ڪK YqKurlHtz&[upxQ&I0q?;gzȸ~dJ/kгGC 11' %),^זee-x.O FkZg 8:*UZ6]]!_:09hNbq]4(! nV۩c3&Ѡ%2n5șI|bSq6y <_Fe6aplAk}V%}Zf[M+Cjtw lD&AC}*lǩ,)H-ƖT&sp`Q?R'ˌqV'}='nMpkWIwD>[oN7V ~%p _ m93߱+Q?[*S qB jMdMw 6ɔ^`cJ੯8qUdb}tх}m/9O^1[ <2L1s~Qg=8]1kc/.Js V:(zqzNb)؄x@ W$55E}.vE)8#;\LL|R":V ( B50^^ C_(;x (!&qًd ô0pb\U saAjk3MzJOޥ8Fnj#C5nOY ,/lAr^BCi ~{LŽDߚƕ#H0[': al Q^ 03ArVnVR"&ŏl;ġ UCQ\ tCݷs;=fVٞOک.a) u |W Vp[If(~?W"iVw)LAL-n2L,2GA@0n>uPlgcS(;2UGVױLqPueգ<Ð8m d"RMzhm䈿LKM%P$z3? pV'id`"h0P;J60mVkA%OIU e¨Qx@A0Ηm*kho[&i&u?rIobuQ)4B% j!-XƙϮDHmןե?;WXFC>eRU%E0=O<~:ƍ2/EKfjƲ'P O}SNep$la:`YMY{a+z;(㗝CdO _aΏN^<` `{O)JΣpp ohEr4:LFflVZa Slf'IhJs,U|dU5m?߈PC# #Dq7daxBAV7GG Z`޾ꋙ@HV?E!`ǯ Ϩ\Xwy EЧ:[ubuqr [D> ;3z}u4S82ID`;؍؂VGȜKJ n`HBHW?$'0j{vݢKkz~(somm?k*V'`Ʃ!6˘.۰>edPRdȶcyE'D.&L9{o &!X\ Q x0"U׫&ZtH(Nߨ* *kwegZW}`z+@d?zRF5Bheshs4zI'7 ?gxoj| x@UOއ;] }^/lFW58L6ӲE·P<(Br0&DRVMъDgUɛwTm36]5QB]m+h2 ,%p*ΔB[C4(F'~;\sy2u& .KtxGw)VJ5"=ڵHf ڳEre04#u.3A 7-ݐesV_)>[@kT:̙F\̈́AsBn\Ѱ#A1Tr!f%aϿX[t_ߕ)-,è-$, QC37gl%pr.B&?n0"%B0p)X74 !KCq& a${n SJ Ф*#zk/}S-\GYHϝ:q v޺ w/[%Cˤ҈r5IZ 4lGn2 ޴k ʩ#Uv ;ܫ߳vߴ}/\7DFZڔʌQU;|& Qk+^2ayF"l6M6]} ErQ]b,clڲ֜`5yb4oHc1&5TKn-&mLEյW}/r{t<^b& edVL)kTn]EoA0gK (MBCω TDթW}`b|l?6(Ŭ3/LdzL~M~lzbF:`^W0n9AŠ࿓T):QztV K~6jy2,Ȧa u]?ϾiGbQ'V /XLȯ.@zG)IIp}V]T> a>p:3"aNPJ\}5l?6m +ۮj~Q"#Ap,)[)3cgā4 6Qe%͊`MGW̶u̾B~^I꽌#{oGiD81MI@>`[V /Nӊ/? =߻*rfG!af˹9F=!O38y, k));D?(PAMKΛIɓE H !ՔNǵd;qHٰ,_94lQbْn&ɱ69T7`HH[Ƨl)H߾oUH\u\I%CS@% lUx^^|E]\ϼ4pZ{ѯR#~ Vߝ^K.kSA7^ +SS}L-y t,7H']VRg0O.Q3b KD<Њ /diI`D]qCX]DQ1uR hkY4"p9lY"S7 [H? mvӮ]&8QVY-&֬7)ӈiMİטǑ#WR'c $SN׮h}?է>2/~^3唄&1>{s5UYCE o2 8& A4Ӱ{}'&k=t('Jt]~J^?(j*9Xz帮9t^L巟mWLrrU1P't?~@6H|XaMɷn/l Yɂ$bv9=. McyVSq}\-jȱe1G/cJ闐k8W HMh0ݵ1\R'cSLc6U NatYjB4)vd7wK"_/A66@XxJ uua<*#_""l ڰ`!^N@q:.l9 IZM5ּ)#I]27~mt¤7v__ xh&uqCLniFrwQ/^A8YX:hNrG1R[K/VS* g+! xd9.ugJ]vCefƙnks!QPc miI & W2 G]&&U]n/ez@!Ikv7{%'v)d9[<Đu CgDEWa"άCre*r(-:쒴0_1rvKG@|3c4MxjC  ?;)彮 Y՗Ԕ,XLvP84XASɈ |. ĥN ᐑ"@oknwG7GWa[%b-L@ T?*2,rlG=<8ᦕVEU')_ٿl~Y:66l/e 7r{ XhsZPwIX!VU8]4 bW; KȴQ$$o( ex2;-v9`K_gs0(P L;SGTy "m - HoI6SA.,kFoк#h̰t'@pT.4ZuP?AS27^lS$mK[`dagc 藺yA50R~F+[w1~1te_ú*z!f167$Jf{kiS Px: ,U)ὬbPܠ!mTTi-  ŕӓ<4~L2ܑelߋk8lXS1Th>۝AJ)ϲ+)K7Gd۬$ᴠ HD:J]긶#['Шr а2+obDsdss<} k] ƛoeOihmWY{IWG| 4qPFD7\ _- RGdF _|Ŷ?Bb# `]UV^ 9>xUm̱\%a) SS~jPj2L`zRusvFx$NG,[WsZ>SN6SHɂ$=[4:g~`WwՆI/#@b= ,y f~IcyfP_~>6##G/jg `Ո !_Un^?8@vDlҐ˧ K4:P@{tM#uSAO H,WO爉ǟ@Y?YVіaݡn@h5HL>\WBCdDl6p1XtuD IC Y'Df۽UV1??ｵA4 #+Jz~aLy]3/]5qQұ"7%( 0IFu(w˺\,y5.2JϏmJGK`D0(MZFOTA3雹N'Rrm]H||^޽WU" OmC^e hdn?|/ řM>Aֺ;w 4B߳ku+Lc7]q v&eobnu^t4@o.{Q7E7F򬾢'&V؇S59Ǥ )2#MwK 5߭'G(y $,DķQ*}ѤȤTD`U||X t54'/rZȑ}RĒ e_Vr:uI3EIK)VNN[{ ~ (6|M$n=Z54rcЗxXJc+$EbHWɦ0I"a$OFf) p!o'S`4E4TyssSF'}3ߩ >Hؑ_?`W1;h=y Mc')KGCO22tĸ^ꎶYt¥5S> Ȫуr Ntlhνu;"g`?3 É.ݫ|`K]ECNq(8_ Aek!I})3b'X;O,D&.*_{D[R o.ٮe}*AַY"(( a#.?<8*kZQRt$٢e`#$q0dD!J޵.60G9m$)k:޸loG4׈c:0ii3zcDKUF 쇂Z7nV^5E-i Y ^}&i۪v6_?3U""SnLwyZ܏C yNVROῦ:#S^A8̬$iզM*YӅlLZz(.3IUT$ӽ@'1;SE)pzK5EY*UnML A]˸05n1#k=IHl{3zL;V]ap) kP0 OSUӼhq3nT! "\CUzYBy{.YZtO ,QbolG+jk(n}/z_d",'5ĭԅq-Qk%7p\,wPgis(ݹkO?nB?Vnxx|QUy_z.urd4Vx 0qʺ9EP$}d% &}zeqQ窕x5^xbDoՅmLٓ](ȚWn;+X*KPEMQB %mZd3wY')0e{:BD6Up} MH45Y7*P:)lE ;lJwޙHUή d UlUx>hR{[L'Ob? r/Ϝ-CN tyu/le/DQL&d+/D\BP \R.yI,yYIuM/\e;q9Gc<R~~wv}ʍA@]_>ea k.+݇U6֔0d'!9 C=b>׸d`;>[^$Z.WmdC M؈kaeA~y a5W*.(mbU:lav$O^O~ l+E]F:el›m&^/Ŏ-# `SGdžtzuY"[vpZ%Y? (4YcB+0TcFӤθmZBZQ`D?)KVywg\eZ[ ڥu1_;-zV;-qf[9Yd8HׄJolw]ޫMǞt$%iu&E=͘gr#Q2Ƈ`-Vii9}Iܮ#*¬ Vٖ+:M5p֔)ѹ.bP}Lr\rcq^Gv+:" u,4gIAݩAIZ! J G_ttp,jOLJr4ʓ{(]|Ą_@ޘoFHIJcÄ0gV?[[Hp4~`Ȓtt9\ќfr z^J%.i˶!#+ t5z7$r˳? S&R\*5\GS$sNZ@((+P!U׈$gCKhD&)? #QoE*3Ǘ:ٛ{0xza!uS0qNߤ&?oBWWT9}@`yu7E 0$3,(ixs|P1>b'j[Cnn XXe_IiQ&B{ꏎ@6TJ8ɔc s"`bӺbf8$zOnn4Х-sO%O-݅ЯE'*Z &Wm^ ꠘ,! n)ft7 Z|{"?=Ŭ\0'qbӏBŒB}HI 9s& APw"3W5W%q+$zjR*Wx˯fFw;s}too3MlXi %&l *"z,dc#ϖ(]\^VlOs8MD_V68姮WZnS|s4 ɨ l->A"X@bT,y6X)M74r/֎0lY,rzS󳴐"3&h|N֮d  `]Vd(Cr? ]3Ҹ8EP7Kl 7 ] 3-XWټcF@{جX><WГF_M/ K&3(hĴZ;q⺈=acfҞB%Teܛ(T$<~_~JW +(kfǰ( <^p q #6)EnIz)1QΒ * qBNpmw+~;|H` 8+.@3ap/%TmadI\MyJj!^z5,fu9t9ΌgUԺ:/ ݂WYwq5+lo`E-wU#jPQohJ\̛NGsV¹9@&&HmhADkhvQފN3T`7TZBV!`+JRLW wuoS[ުrtzXiP-RP5u{L( -dfv2B M7*0HȶI jK{YkzeJԨdɼ[ kٗn:;] :a;S}QmWOv6968 x" !u0E˹$BP`] g;A}|i+AZ7s^"W "nno1;!/%9[V t(s7՞x(hCfR?ؐXzD`H-KK$:;np+| U"D$j@%qCMWizt T3c wNIheM36ӊliFOCBφr{0 eAp4eZls=C#,1 eaݲG[ʀ\ixqQA4pwe"IJntO݌(} xJ #e8kХGc#jc&ΙU#.z Getm`CO<~y1Nݾ3`)5=AE nzžK@%Xra+|P[^W੧)O 5X2~Ø6=1a}Wj1+> s5^Ioň]wpގ(ҚmB#\- EDN}p<ѺRhFPsW)t`PۢOD)U/?G>"Kn=% +7ߍ.C ~{!CE8y"pPʇax7$EN L%ĭLRּ=;g> ASlaSNAWz$S뭖<>N-bo?G9ږ]1?vUGxa 맷k(C8!b%Z N [IqW&v luAɉj\w"F#1j 4`9Ht=l"6q{_Fo1L{FwI*;6z$?ށ.IkP*K{1n γ> e5=j ~א(\[ bE3ubj_ȕ_+H-%ϬSNc v "}hV_ͤ%WX"!K KW'|~H63w6Jk_]h0YLU<(?ĞuRZ\#O"+CKW: T{8\?:v)VOԕmD?Yl`sVKֿ-NUD(jW}ͻ|> p*&Y0# 3(S'p߯)z(0ΣL )osih*Cԛ^C˻f6YDGhav冯.pGTµ0RHbR瞎Fo@=}u3(G-@b$<#fԍmrQBb{_߀TC֧V&(Avjd"8,mw)}w?r+#BY "*Rܮ:? ȹyuK N\%Ö&)Q1wA#m}}}G MuE~[6T5EMڑw/)IݖK*? 6 ,/fл2.9F4gCˤ)*т!rF^( 4Oh7#X] ݳA\O}Os'RrM vX|, xgߚHZU^'4  ZIz ]g '`,\钀Jm7Xǘp p>eYqZF†d1Q]}ų^CB`I*c IXۀrdhv'+]Uu i >Zbǯ -H"_H]tb s]%#+&/kJo)6񞏰 ~ʢO{`@mAg{H`J/X'|j,C>".d##bŶZ+| R@FPՂ[E[giB;qN~ٌkLQDȡ"1Bx~Oy2J/WNb\X'g(Є0"ѰRe0IgUJ&'Z,h`~܍TarAӢt3z"% j-gOB:Ίj8fjvweBixaq}*H(DF|=ʱZwDEN vX\}6P&aV8s)0JJ[O(7ifG'S^gxԡ컗krMdhz2[%o͸'@A$xpা^y:K[K& (Tx)X&V٦-| 3DjŠ° \(͝帡* c$m?< [`](>TMBLA(TNʹsT&/l&@5>'4;VQ{_ǿ1[ٚW+.[yG7{-gKVP*qG̴O7|a~e3"c.ꑄO3"|wWHo~>_Z? ~édyt7<'zYX]X R薜6zSvXM.r~4g9=չ''?O_]ϫF#0?kLHˠޓԪoz2a9zF g:W,˪BiہC9:]GJɛCВ8w~FQf3sjvڳ^»g-Bu'0"pXchD#bsnZ+ UѾ0P\>i%Bq]/5?ӧn;ưY>1~_ieاl.# |5줈>{[BKsUf Z7A @v}J} DWXVI_>dF~\&+ DڽU AleB[Yz7&? WCZzi*A&YIsqnyċhD0βe! X.ذc, O F,ߕDi}𨇔ѷxbD9+l).Y9\ 'M}* Fx)6t6Rٴ24OQ q}c֟s.7?o5;{ƮuNDTPwLSL#@=Biqrk'nrE|ē2wL7vUF|hBiT2jue`)Պ>uV;t<Z6FI0(nOn L=v/]e t2!uyP۷eek}B !MN ,2T4uQn9?F^Uɘ1tr]h3s h)OdHqM:jljUXjFoϛux{ZRsM UHmIȭ7Rj< FU;fdRLT_;2ڬDNp-B=}tjzhV|櫝:|rӱ\C˘1&'Šǁfyd^cT{0IN6wM\l0,4)jٌ I&:=85_%X3Ҟ(j+7I)J;oR&Yv; p2DDwEkܻ-W: ~fd2pI { rĢ8Tr%6CX`5R"-{s#5$Tj7u5Ǫ݊\9%E,0 0k=ȪA&N"D%HgvݎFqhscJѢj9G߂v;=$kł4Kpp?f\  R|q]gKu %bNe$m^Ο>*P˘P_N\K9'reZ~z]Xr% 2r2ڪkuM ? E|Fw05|̘>N+A) : gXmwŦj4k8dHF >{Y=!m״nFB-Jۣ-|,~Eo4O3JGEbɰ`StC`PRG7bI#)׫ÔBwQBDzcҭrp+P ojX3s@PnZL ]# < 'UaOv{Ռ@Flȵ}ty)/(WLT&yXeyv"V]O'Fqp !  )C\H$Sw]m-Fy$a#DT2t̡L8VW:%Vq^3Ԫ@3gxYJ{[[ANyJQ!I`Ip;&.X 瑧| _/ ~ZaE1s`JY]x,VHo+ Om=[Yt"wH]O7D' 2#xըZluF-hci .)N\$EP4``Lif=Ɲ]ELY^{N=0͂;˘/-q+q?sв\L8CE͠!HK3m5AY5%l"l]Ur(q)qxƠ[8O}II]ھahH訧7*˚OCPJ#?ˆ+3w %oG }#{n&ѯ2إa4+Pv[2H  >RRKohG3]"Z1hT$ҫ *YӠh~y=NiE/DƔ0*3hbXC߳n+ŬQ҉A+z?:I3Ď g^2s~A&Wܖcr XFc OG ?W'lZMYjd>eSIyA>`Lt#^!\|[_Yl%̰]CK gv)` Û ﬷仝$N,s_~V1,%[(X }J "Tm3=PHWL,@BK"bm'-HM#\9=7]b9b@jɗ<12)lFd6f4~@.ktNBNnF;B\O2҈xv{6^G0D\=VX݋+0v2OBЛ+֓!-$N42A6Rߘ^v^i2jOvNID B􇨹=f@l .WI+aɩK GO7NKw; ~6_w3TYVoZ|Dgth'"!6M̲.elodRV Bv3g0ϸ%R%63 FRKÌul8t4$xjiA*T=K9=hSSm"Mا RpnFdID,PV嗳?WZYg`!ˉ)oᘶ^au$u(>s&N}*5ŠF~L2;R9.ϒ6 e,hP|*QI:Wob-ޥc=f;wPEKd)q,4 Lk{é{<0܏1IBB&?K||˸jtKR4مq@%Dmog*, e[Fv U/Z=23GgĜ}gaAJUw=G$97*Pu _?߇Բ'${QK}ݡ߫m-3lnQbԆrLtaBNS¼ ^)E]o7sjv8ճ ^pX.ppUE(.#@IiDRb(j8OQW<J +.Ӻ1zhTk>n(KWx(C=o`ص~NRo@fBsmeNk%xL@o{/!7ZWV :'iE1p{]r /:/7nM*R{RC>)L@jԁ'2rx4Rk>Lf`RL <n>u;;״VJ 9Ί5ZzcjnjWn>u9"f Dt`A]xbV.g~RcXc#t{a?,L3˅{L7Lb\_ <@-nSG_zĩpD|L Bl#{Wqry[ ];>{ۗ~vlO%iT 0fXl-Z|#xZH ,GcsmIf纰w8yn L:nij-t$baDWh8Nir# yZ@}Seix;˖[Ma]A:;'URNhZx.Rt5ܫ-uހY:/0eFYx݇V^ ?$-[m%fXBKjE+?jaGeZ~]ȁy^!5_dެ*;svw/q+{ ,]Sj"2phL |Q Q2@Q-E~ Kv^nTI TSKD,NX%v`3 쳄?9ӨJʆmTsUUY2i]l䲅Z^kp#XG@lbSܝ X >{@ dYޙB@J6<;#((1#{җꐱjm FkA<:f+E4+XF6 2`7s8Q8ؤmU_zF0$KP" zi= L$TGD y®*se@#z#w& 9A^~bGrlm$ oT_ODry(kz'h˴=bbK`. 00,YzoS9>w[+o(6#@̡3"$B[$UEIZjmӃFU@㽞+@.X{}́U((ԲH 08ܝWt'χY}%b{7j8|jGK\01-Y:R+U˧ =4M3p%CpS IXКŤ7nGl2v6`]qPuRA 9'K b2_6H#:^c|{Ȫ/Zj/^i@/k#;{\bFgAM븮8q)[.s8h1)?XqLTGo_S.}΂ yTRhY5޶]Gapf1jWa]]3'}rd#`5Cu%k!zUKq/ Ls +OGA f Vkϊv0>y{f@6ӦCDIF} >)1&Hjݏ}Łq7X qCÉZ~,+q3^5D:cT(b^#HHpt{ &e!c'tf҉%AvJ)n9>x~|ӕ ~Ek:p|TJ(;ǀK)B.:p#. X(7ejŶ3X RIA7 L8ɰoqr@̹R+qxv"-s.L0Us M/r]'- Q5{9z~%/[MR:A /dMώ C<́; m jᜢ.ِLE{~pa.P&I}V>zgL} Tm<3晘;x ?E)=J<ޖ3&yef`YڕH }FYR/ 高VJX(IZpqϥ9C\$@to!HL}m#LRJpL Dƒ"ކvu}yj gߏOc `d\|sY /ְEWMU9sk_Wes&E;JBӵ0 p8ozNWނ|Gb&*:5"*V_a20 ,DH2MNy{] Bz2qR#CgxB.}lJޭW13e_**lǗ{A!1X2hnV;Ŀ땱S1?$)nLw N-H|<=r_]-&2,>W/sz_w *~<1'b,LM6ĘF.k mU9F 8Q-SVof_~eZL{iU0C`k?yD${#]x?0ҾsH_zW #0O_D^TDYwrޠtKTKUYbW@}?!L>s].+,҇ȺS 8Ȇm;*礶mLu)G5lf#x4*4?bٌc6#1[<9!n} 5J/<5%( D]X gơ"(^}#}G`V+ӧ&eQb ~Jz7ܼ?j4J Fޑ&82:A;2 yPQfJec7QUtkDښ qf4\#N\IWڢI*h}p6li=H&U;e"1Oyjz 8ϴ|]B|Z'?BWM.,ֈ7M*B5m_Fź=wڱIS5Oy/e]Q zdNGloʷndˢ;!ҝm6w<B")*>2&O>joa\vHC8a6tRFBYD[TNHycW&%eW}MM!p|1$fْOFtYzt|#HDu0hmZz؃+? =(SJ-Q1XQ8= VFvUH+m"Up!?!mA-tپ_%&؃()ȉy@T`f9$ظ]Ғ]_*46t=s=љWGnt Rs 矨-QG D,,͗qI9*˄'e8.C9EMb.=1@s^Nǽ)X9x GI7a`bF7(,otyUR Et߄S%nx]] ,%˴)dZIu*<hݭFy3}Cogtys6zRČ^X U 8uFbLk354'l0wdEX@;}08ws}4Ke +UcIςC/m+1Ba>;[Pg 2a19q/&vGh":XNG1 {Ƶ@pN@3p%O|R|9l-f*C؁C`nt{=o 473q)qDjB%'gCuLJQ ^wkqaWٿmAm2^lT vk/;BiNTˌ!p;^H\}*4$H0S݌+e/ul46Mhp~l@ M&BySE*P'2]/X$ˁ[y/9I {|Զ$-?JuKeDMfR`ДO#U 0j:EDQhϮ[0K5juF,i5\,EDU1%s0Wo(tJi{dmݑ5Id;F.c si I^ӧ16x _J%y7*',@B< S&#@ R:&$}7xslRY`!QŠ\5OtHhE`#!זT%i#Q&N`\n }\^Y*ldE|^FM283ֆuސ=8LWfqBU*fm)R FwW =yS YZҨCODn?jEL"cY\Rv#L1e@K^t};`V ߁ʇo$p-K}Ӱm u!1hPmPa6D%gA)ԯ_DVLiǙRs 6N0{`Ff*T#/\p@܄s$H"-dz2(/_6J]ߩi)RW/Zbm᪥z>?dryLDJ-K:U QRDj<Үo bGCs!pʷ.bNB]4G @TT(X۱&r2DJ>iD~7\_bnt)Qo ^nh70 ƌ[x_ D7h7p5(^BU'W2FrǦ g&x,,Va\Qul9RKH~r?)u+eTu *:~" w5k?À%eN54)(l f6)WJWd;yxwJO Jw% O:{{qv e<ź0ykƎ}q_3@e-ms#!C:iQOU9Zj@2hݫ{ľlΟp߸UYcESwh/,/5z&VrF;Ns?8,M~T?ˁkpZhE sq\P>o^ :w*w@qA9X8ibBH:] aN<g 49` _\h*uW>{r~hCq*wFl9(ֶ R+ ȩkX60-}#nݯrDMdIޡQyZԢ9!&GMϑetUlM>[qF^Qn28pmnj Y1}ز@S.|"V!%Z@}kZU&I*YR5gVT|R&X*G8mmP !Sv20= 13 "2:943AbuݨΉkE:A.mTKPCJzŸ4pP t! OXBkX͠yNS5[ =zX#~ [Rb..lQ%|Epc 0B'QqO{ R6hj5| (K5%$;~2XŹp1~:=-_yIy\p9'#cH~XݞbhKߕ2̨să=rZ^H</H7h bb7l^ _G@FIJ)Z~aSőly*}Y~PsH@9F-ZFLW贁b@Op QP)ZƝqP\A/C-tGOk@y MxU}QݘT)Yq>3}N0vȈ*9/~9VH9,-@M֯݅*! 7cRwd< UZ|F$\lR qF>%dvh\F1LJ'O4wLuV6'a]y5ExW =@2Oʮ8nD we[G/aW]Ccw_dBgK Jo[Hbm Le. #)tdZ" [r0^ؘYt°XSZXn'36S[vwHNţfrsqL+B1ǚ 3gQ"IjXxLP;Ev/Bl-`%ҕ/n# **9Ie/Yk2mLr^[0@Nɸ=p`][qsr'¹-k@gx!n#ez}.1ˡ%h9 L^4j,c#{r ϜˍjQ`Fܗ^kSdz yzs{U=d3@&,rqvP11D+` `3?&MEƖ9nVLVxNap67߬u0KW'Дu\ "ZfIAZQ[A^\s+: ~wuEʳU ٶ;BF#vi6pMijYRE->u_Z+'M:]I)@#^˩ɣw`YkyI iafIU9*:M9LZ5o*.MFÛ&$1 G.=^!$S3*$A` 41*Y=܇{ V!=P]54aڪp1\ 6.Ao'CȖ=奫~6\1GCEjk=ihGȑi}jJ s_2fe[\cg6"Rl·=J@3B"6S_E(wet7$ZWw|R罊Z]fo%#C2ۀ R 0k|d2Kg"\" v֡5hSO`4dTi-WB'N^41xo>ŮV{̹+7O&{󜩐ds>*s7z:?"+|ȎAXR&`^gS_9Rn.{chP4x ՎʣY5;SՍHZxX1c^$;cgQTuX![d\%e5D}r̳4Q~\"׾+ʄH` k+ c:+$4ٷ)08t$ttq ̒8SVvDCڑGD" =- )s Q,W!x*<%XR|}8 w_h,]~%X>D+ fL=h ݎB8Qĝ{ykA^K$ XcG1w~x_;rݒ{7ivxJnM]؏rM%rKVD?@@5HADOs]88c@9Lt8|Fd㡕,>tt1w}}NbLh;\GV34OemcV\&_BDn'k=q:LhK阹S[y;4Z!X2مl83:yvuPFiK:h9 f$T_ \W:("UX}UơY±4c7C<͛meK+C4BkߔзQ"EH\-QVqK4jٓsAKK?]:jV $b2TTUp}#釲`SmPv3Nv&w7'ч{}R f mLG׉o&|7?kWaua䤡2{"W~|h4Ԛ!)yǮ$fD~אõEnіmjp#Wm.^lh1xр |3cYcU{y?s-ue/\4[OAvejp-hFb~&L4_Xe~_ʻBQ(U{hjt ^:$q!C1Bu+Jrꏈcb7T qhu1 (m Q=o4Hx,{iD2 h*KPZuٱSǕ548zS(@<)SZ|L. L7j~sȤ5P;_{䍋5zMN 6R~}cgHOy]*-w2d~64z;IUGy*1O$,ltfI :&0E…?)Jût [ڸԖ xgk,_7iu?ۙ=ŗ0d@b/Ezyn֠=d!3J}sK29D|q@FdxlVS[+S4>G BtPHSuS8 8'1g3AˤO6E -bJ2O}xQ3X&i(Rf Cjs[=t\aB`1(<ۺL|s:`3cv3uP,x#GqR컓٤#h"5`uyBXen"1XhtmdWs\/_O7:yҮY<9ufs,Tz~^N{0 K|7OGZBeC+m05w!ϼ3AϳYJ,=wDeL,L10&) [DoO L?;ɠ/ʞzvix(po'qP͎ @ WhGCo[p+*8e9)7#>'3١O yibwhH/*viDSB@egrc:;\1BsEEHʗJTx+!(.8Aٿyr\3  }`x~Xs82 NH/;=?"4(`I#% }/5T.+# RѪc@ مB8> [wS*/WRYev` ԙ W !UKͰp0ouo;ʞ샖 ttʿ#F!/$fᕰYI1']`_[)!.ܻqz'AyNE2}g禱>vtUg/>LFV TJh{KHb`YXz\FY@Ng2yC_[ʟ T?03|7'>@ƾ$$q]uFe6gZX bô|(sPz+1kq"`@uʳ`Ik^' 0@ba@l x @|F5U")@՛O4u>~ܷ.? WcEK̂51>Q_TC53+ w"H銤<(m){"j+Z>^[W5KwlQWAG`錊Ԣ[ 7A 鞱%!mB:*Fœ(ȇW_C4BriӦ&O?ux,l߱=\088`%؝sфfLL+Ue eS'Csƹ]o_B*+5OzqaƉ?9Kj$Ն,\/<{?&"/N❸6UbI0JߧG[h0?m 4-/c5jA+gb>/y8~boWAyw{7 S5 ~Y Jf}?UFo3ْd ^zݿ|Ā CəHVՓ*dkBНbʿL5t4FF6}_p\zHd[sja%RwC*>䂅.#UฝJO__Tihk)p]qZ /K P衂k2 /O\FX)uxjB $m0F!nN)RezgCw] ȯ B`jYq( eJ>3a fQV+4*Uɯma; "cE0k1*ݙ9f~X&E_3%` ^ݯ_-]V:R вI×y'v4W5;Y=RxE]7E/Du(tKTo%d՚uV~ߞ8?R0faĦ/g9ʞx;3Zf 4de^"sl¥Wjld" TFA{CŒ:!2/ )#t )y7ll6:]_%Зz*_8S͠߄KYCgX@)bxoc6շ%C.(? oe#d*"# D?O֧_-Uޘ,!ӗ@$t7V#{( U(e#'Y C"NǷr*ON^Z#!5 mP zTp"-f /G&!LԶOZ]rQa3.^sGZA ~4OBpAѭԿΙn` V#~E>2V $zKh)8OjºJZaj~Ql8K^'^ QQxfqg^>;.{,Ѣsj}Xn$oŚcZNċxYOp@ :wVSG׭ڛKx`PeovZN;'9)~&vN IϘJ-PzF'~'ovN OC^$Sh'Gj'R\ҳqA@~iῄ.E1wBRBI兓ab-k ocsW.Zq*/~1>4ahX@::$&`].lM <=ɴ _,Vl$SˇjwFjw?ϳ8#ѢuxKk+w!Ȅ8|Ydo](.1A]K=0Pyǎ#Syxh> \,"vj@lЛqb.ryBWFx*JZt)rkE%@KKRdXܝ1ذTI_Gty,<6>rSA< #VJ\d>[y3# va~,oYfe'h{H&ME "SkoHŧݻb| \r nncVތyӔ@P9[*ҰXͩh4kݗ4kYAy'j˒IS0F'En 'ZDCC?.;HСyz Lٺq[I>R>9xƒ/5{o&"xXxk ~/K;[(`|(F&cVmB\ 1F)+aŽ]/ܖ,F+?iJaD8&}8~BVhn+fY"a+ !@iF_F "L:߁f!.$ 1&I P4ÂxSN_`'jV2R݉kv펥D7;Aߋ'%IȇCf)3']':Fe@dy/Ct[HQf0|+qaTwy;O"lqYs[֬rzah#;c8[zɨҪ欛+`NhE>·1. ZUˇ[ %upoV!z ho񷂐f"{wCۡ:Kr}fE,m.Ν"^)ߖqдeretSq'y[+ܛQd 2_ʒ+jnt9v8d6u.n!Yנ!G6r|x"l@_r{OD1ҹ?.Y39L4ԭ9aPPX%T;8 EDp韏n-U\@e}aZ梽a:V Jog G-x7Y!GQsfoE6b-}XU}/|WSa`/@}ofe&w3>]V+nA0P4K/.sl/b qFŖ"M(ˑK6QZXN싚4%T#HMC!_5%jXj0#49,1iڽxrxBLOS>D0d}︣-0g?q8_ xGvVzZ.CYtTCжm-fz#p$rg)[ýwDדߣou2$ SjD 85R=G^; gJC7}>\ cq*E~\l*ATx}O?i K$uOT壜wgF/ja@DsM3{[koR;&ĝnǸÚH 2mMJ iw( Vj8ϧMVfx9R5gh*JCeK܆ iVȲɑ⅓ӻD pS7_+ܦOpT_+ cz_kڙ:ǖ8DQqT"e2`<3(Ӡ8 XwV4SֻE/>:[bʮMJ%Ju!1ø 5>\L|I3-j0`Z"2M8@gٓHiPXr!~1FHv^z][׉FH؍@˵NYnQǫ}ER !q{9פ!fE=$ _S+oD.U!$F 55/R2_1eKh֭b 7U[!526jd8Guh 8y | ѧT*BC}k+DR@P~t0+Zdh;݅ڳ]a!nMI b6(Yk@ƆvgLFG=T$:pv?'ٴ׭ofvT' |W.Z(&A oʱ1J `) ȼHu})z]]EWO}*UQ(L{*U ]wP4꾗ѱ;W T^J[4r%A`\ύUhso3, ̘%Bu.^lF#4]oKlRX!3H1n Ԟ5ɷ[E3Y5k c48wj.]w--#i/И,]و[ID8~6MBxeZ!;A(r"Nlg|CZݸ0qU-0Ǻy֒I}Gg#,b >M/L?{h1TB{n1ttP?| ^bkK_T-i 1~E4̫̏'8Ks!_|iCӧӶFu-l/I%͕Cw5&ih=?Q:P>NuodGb [Sg`d.*FvC$4"UuHFގkp<]!JAz6GQ {4byA),[SL|; j>D "r(Q<'EW#gW1&o0r xzߐE5+ JSKSxfm->MP>iVR+Fs1} D(С zH2/dNNxz{,׮Cw6gK=%c5 ux48kqb#wRFw֜bh:9l ~r~f Hֽ1~R>zr^D:kHYs'ykYe_'q?+AmgǷ} :bK. [ZRqdAS)0je<Y=m&.A kuW5'KiQ@~H@O- ;t?v, 98,ja̴=$P9A~ y ²b|b"eW#$o1Nibѷf(N>J,yNKIze`u̥KM,zdBTVʅ &0 ꬦIvH%VX׳z =Ҙ%؍>~jɿjv)1ci af Zc>)$SYr)\kwIZF7}ϯhJ}+`:UD{ Ѥu\}*4 qoeBKnFU~Τ:KU4dC/?4rct6[4 qD=y75NvM M탂~$Xvgm֙󼱝2Ԥhb VF9mPPmm{4φ\Ń.!toѰ6e:?ߊe J=C7 (*N9y"G\p=_ Yp]3JqٙAhF<ŠUqt_ 0-"ĉ=@w,0ءo-k?7؁wknpr`TȞd7aU)YQ`~/+H$qrVNdg<~St2nf6ph|k }o~{FF] 8X %O}ܯ@1q $3-0^ I*m=̧Dq,=^&_`r+nkkoؤ/E]&.@YYAͨ_DBS4 FS ts՜6dl~ vf`?J_}v.n{+4r[8e1/QxdDyb'7UZxkrkRS 壨ex `;;7E?un9迓XY%+`F2k =CZMӡw%ͨ/J+&\Q|c\e?N&=npbH2+"MW#"׾~V RUAZ63u孥а|{{n9b1pJD( WZH pF OԨmscPf 96xP|#Zes(2_Bdorl_je}E +*@`a` bިxp H>'yJȳWל3igȵ@- )Q0%Cjسl=W 92s6j"똵b9͏| GcrG)%V5ԤHH>*- 9(y^s(e5M!XfJJJ+p Hl! ﷯~Ԝ Ż1(HK*g}X2w9`Y%Ͼg~|s_aA0K_XQ+`hP u5FD@ԬxB\#adP8-C*:,Ob( ڒ$\iKa0ÏBih\PupE-&<-ɍ<^ q"$<ԊCNdZ;Bh([Em>zCԣ2,9d2Ptl7 6F:?.--CvU3ZHm[T]G78nrJL6g{p()4Q~-ö}*ȕ3[CqFaQOsg)d=a|$j `wGoJ(ЖSUdz62LAg(Q }ݍ[!h(}?ldNyɡ(o}yy"c'>e(.'|y6Pi̫uEf>n® @uWZi#2G]S!l9-t%JYrPm0widoH^@ma13ȟ$[: y]Ӆw4㴹ᣂOh )S?$5n[֓Q߄ pa03WjrL45eW,&닫ө͡A빠| 4` =zb7t^YmfwU9F2B ~aحsX@juQ较J?:N`>L~fۑ5u:\C(b7H4R\ Um[F1<كqoA4f5@8RiC@B]WQ#Yy&n(,Rĉj-3n`^ 7?d %2i27Έ-Hroe_ Li-ƒXl&zjbxf׫ѭ1+{}쪀{:(qڅr% G4SȄvM\!,RМR_I Y'W,r) h! R_~U7 5\yOFOM+f3~n.L؏xp`|ɧS@O6C6@7!2Tmv,h8'c3tM-ږ'꦳SzYkKJm}j1>ˋdz',h"e{pJE#}6l/ K{*Hm]ы3!/p}q,ֈRTFa-z>I޼)a?vY" $Q)Yƣ@$ 1@-4ӡ!/ʈ-Ğ南qa(F]n Egw;R B܋JULܚfBSI呮\JOae6 o{w4<=芢oeA:E4"QS~\F%$30En^Fs*ҩ»{ Mޢ w$׭,ئ]׀u6`N ^q:/ށ\Xpa/-ϚvɰR/QGY(b110F;S+&g$;<@Y(w騳{o&vS8_㦤iv'%E"(G<,m{qBOE)c,z;N]δ)-0/0m"8^ &>KwT?~|7l4H^B;bBN)W%R˙+d}Y'=)*TTojtoᬳj= iܲċUpcPC=r D$;͉w [ `CAJBP+3Ne2YGm|kVscQHU$#?LD\~9 JMo~sYxU'dl =5UNs jZ`WUF -:*_Xu~cނ:C=V22ٽn-Pyq,ut^ЇOJU^Ni8e˷ *M^v~@_eWgJ_MfN*Wt ^Mj a\<-QZҔ9kǿN 䦱 ȝHqvj+ CF3  ZUx!уəub4d_bxՇbL`yEamET>M<`1(e_`C)Y9C-/=5r^pLpJ13=挋;2Q{71e[ +!`kǠ&p_E^'-\engg4[^3|(W dPKNVv4cHc^۽m([35P18hJv9B!f_c2-H鷦K1a SQ? + :Zjӵ Ƅ_8"j QOڟsSt*YBc 6mP@6lZ+T((MܪUMH݄l6MNpE« hHQXE` Vd+kON'UKٍoNOEՁ#p$G"5.)v^ 3vkDG|o80ԴS~x%v˴† LP;'2A"gjkv6k`L|XoRT?aPL{3!fSp;snܗ4/"ҖMD*7AÏzMݿ I4rȉ y˓ HvR2`>{8dIUԜ@MC3$ߪsXϾ S\Oj"?ᴠDӀ@W+X?"K8dξc!0ۇO 훁f$h﷏ϳޅ0ef2L̃ԁ,X:P`{mԈa#J߲5@h8f/wuj398%2yf Jσ3ZX ˛Cz# 6>FT23`OX}!"_.Ќ 5L&նT񂘣q6A>k_"<=_JFtD2rQ K*PIoz+ \@9&Dp|)*Ie#$ĶqdKD\p9EI~{@7D)&m:#upz7SOǍ( ,p ΞaARWE_W&@W9}#CR-ܱz 4O\i5B=MC"r;`fuqn1<ˈ5+u FqPl4HEFJ!eg*lX\[96>7٩QD ub,UEQn܏tIu9O@-`|."n`_ִ݆!+>>w_Eax)4\g1H3̦\@Dޑna, t }Տ.y.3k-}mzF܉X1 x(Aa0~lL υ\wY1? kW= m>0 A_D~^+)}(p0Uȿ_|yC rt /)ɉGRqz0FVPFVreS5ޔH,((ӂn찗11{ʹ(X`9>6)>=>Ň!_V)DţΈH-b>Ӈ-y+ۗh ?VBn:Bԟ2~ZuJFP_[F_G$۲pxA2ZbLpR1>^بkm@u:ڐ+{J NWRѿn4.+0_j ~UoVs@o2 +pߗʷ5<?t)4K/p~x}}Ly /4FqJZ\.=cє'pm)b0XID)rx) w/SI_d=|\‰n4 f <>w?)n@Xnh&r0` UH;@1]:y;ac:! CW"pv{C b\7_hUʁ%-},.ӭ΁Vc,D'~vNo!U]&RQ-X1 }SGO{afFCC&ge`آqyi-`\I.HT%bC$:` : %^2"jw~cĉX;q؅ ei'rٳJ7p̌ `ADxj%px7Z٤UA-ƅ:?IEΥ;?]S҅ pNcɠ<0\>僺0wf"}pV@KP_ٻ'[: m.O[]cM*mA0w&P%0*R%(~Y&i Fw'@K'4-~X);h#zӂ_= &e6`f,KN]B2)«[@#p_[h(4bmYC=E`~o['B./>Z2g- ,;-[J)" oD3vUƋ ! 7)z-`!Ahp[ͪ%S>/HۯȌT]Pq/`A Iewst܌PYeHLnR i`vs `.ayYL(D=G"?^{eO?ܷ2Nrr̡OvƤsǃw. вhا5Xq:8^m#>4d養WpX)jJ>&KIsD}ĸ]Үb@iB1|<eTlnAӻ)Mfx+;O(^oޞeΫ^t})K5rY].7ƕ?'KA؍w`X|؆†F3y_H5R =ɌX9T.Lt 5#btL 2"B@e'K +T.w"'cA]1b4e̒@h1bL%qlR]W1W(FD=GVũg0*ܯ:qsS=D}CNشj@?fzh-]~"QV]cl3hk{ *f 7gQ# "IQ7Q{:d3ܖ:[ܖA!~!h cd? y> Aԃ=dB]ȍCށ>_ 0y,9??F,jwIF[)N"hź! >ߣКҕ \r$l8 ܇xn8)컛Bc8,awz%G]Lf^JDM01 zeBSbFIґ2'/7ԎfV+0,>Y|}.= BG;&*gȜ;($$*г!zWm'h9зxjIGu6X-kL= P鿶yխ&!)#"E}/R.x-[3gM{4?D<nf&PZ*k/ap= Ujس|: r2 a) ҫtʔV}/JeZU40/_T l?~$x&]OcB ٤{;b| daٻ R'p z1C!vAMhm#}$s0'X̦\ cK }}2 3H_"R-`xRl꧊Քи1h ?ige2S9LQHFEK8u&qf޲ /vZtC`(Iv`/6]CǕ*I I> qK 6IDzE2of3 wdI & S)Sh/vVo |&j`4vm14-E;m;ȫ\]%=S#)9^3k0E`t^5r\A5h,ݑf0gc{2{ 3avTc~mڵ 5a4.Uc6A^WsT`0h|Z;SϝopSmo7<[YG qS$glfӦєՀ P8>jUs4CAJ5V<ӞLsx=GgBtժ/e%9^9u\,)3'J7Lw쪕 .eJTFHP5hH_ τxYlRIeMt[O=C0K8 yǚ>.yo߃:\ȦyJAN%vÐgQu^V= ( BiК7c)8FTH%3KPJ],avmnM>v#ݧYij Z*:Vg!VqR }) ZJͽcύ%ev vۀ#8n:ߌS)熲 *1o+C{l+i@u1}Ѹ ^. ݤB E'k/ykC+.22Hʐ@Ǜ.)顬ߐ>zm"E-#'?~@P2^1y6uޓɄec)4HjFx!FeJdiY.Ev [-8yS.3Piæ|+hRWLT.}j ]Lsi<4RboIY?~O$eMzt)%xi sԑpo dG[ Wc=ݐcShP#8؟4M9LqGնcӴUI iKXqg<>*fV/DBK$QԪC64Ȁ%묬BV5<tm.FNTH?mSs0T۾U%[6m!x]Nj>c9Har?Q2i#+vNǵ#)C@X<`0 hPv[k^i+ /?4Z#Hu&I=_} vwI\XM4jRVGZpઌy4^mtFP''-R/ 4RAe А3w=;\i/7>r IY*%5Ģ |+ fZ>luJ9rd ݾ2 }o_  Z ɯ )/tТ$k}4 ^.ucrs/@d@Qdoի$q@))Tv\>55Ɍ´AD)T5ܴ1iY" vTA>[z`7LZSoe5ycLZCy ខS'r:R fLWix#|^xrFE1T#n1lLzK}}kɍ,\Y"eil6P^:frDofΖ1yyg[Ƞɺ͸<bn^.ZuL8#T,N3`'J{x*J/B=Rڝɫ/Ezk^~ 51'W,R+[׮c̛FrLV)(q3uSw2b$CL716:?■m_`G_LG.d_.{UY< _=>>Rl=G013W])TMpkbXYW6f_MLSgZaWAgs`9{uYȉs ldj7 XkYˠ"FDX+~}8=лDӖLn U;1 p^ r5kP`9}gt #)|B֘Om! okّ BѶ F!0\f .'RE+F"!U傱*)ɻ0i g 82 bYaS>(h63%!Y=D-mjWmƱp.NA0i> *WK\pQ V#WҲ`r_CV;,BTgnsH歓W`PM\#1Xs +}#{콴EܻMމ@d/o{ß&u!C|rT09Czm^ FbX44*LB_j"˥?_8eYA+ݧzsĽ Di 7:zY9B%W9VP8\ޡ<%O#M/Wi`V:ŖץPZTo&旅(}̖)sNT5 '߸J3L{+9c>cTpoQ)GIF**-!R%\"tm76MaOC^b8]sj~W 1-d\?6Ÿ|%2i=L2i*#ȡE[X/w O(E +7t tWw٬x1Ռ[)M*rsJ+Dj~VسJ:˕ Ğ"qgrHl_&Qxo5HD3]Ş2 Zj"S&iuqɄf.Wt]P>uړA[Uؑg6J(LGYvLT% OMpAA||c|L}K՞[12Hl'Dѕ7GQ.=!!2fyZ]7:ٽ{䗁"_% ,Siۧ;Cޥ_k{oqBitQj#7 =OS)Eٜ9 ,j3O4H)}[ CG)3M}/EpKoC>ic MwE71ު֬|vI rnܛqG-k>@Svhy}Rt1RPf-Ho۳ޞGS'R\q+8[Aì_FAJ7JCm1 ,LIJ[蘐;^ 7MS|pb:+θ<h`3z6XkOw24|3:'O@ekKLԡ#FŽuHq7yr@+=ۀȌ>BRYhh ?, k&bPҦ._B9Z(OGIWn!..gcTDT=]&)r.fu|}LїМVpgs2U3TJR?YkW0}%K"=Ԅksuoss(Q$Xfw2}0 O,w:ѸMFb8"B K< N$ jT#I0wZ  _QN1- C;K} `ތ^p>A(F!T0iZ,_itm!Rq`jA{dY]Bc}/r6>baG+ёF_HEV- Ԥey2Ybٖ}ȟ\Kem uz"㌪Ki aݒPq1%E`K[3?. k$4'&+pSw!^{MԈCŖQpIE+:1I;o]3&;w@~JhDC UI_ju@A/-gC=MvMXwM< ǯs@ LʙYGUUU&M!*i&BXM H;A]۱ow&^P~UN #7agMvjCc5O#ۛ>7HH œjEy+J9 taa"~QY/0b)J\nH6rV?V{ {'Ckr`\?#e?is9* ȍ,gG%)S'< r K~-1߀$iR(Q/ӯa#0Xq04Ο\9?I'i#s;,IG%kf8B,WÒ k)S#%j,*(8]+Si?O;0 Yr(4e =p.aZ04SXV6;}DI Ca/uge+\V7st6$m3]۟Lkϩo(!$*`V^"HZ8n.Ā1%8I:, v Qɨ VfwZ4ĉjY tfyZw^d?@#{Xvi.%Tq\`= y 'ZDbίrtտ“7y"/+ Y ,!׎"].*VZN\p?Xǔ Ss*x͂T  G=W4&-#d鶒$^_I_faU>we(#p®he9V|S4Z,RP:|`1#:vF|`َ@|8(蝮/#JH`oCMXS.m)U[ 0>8hrsՀ\b)}[hM)cExp ds>'}'Q2{a>āGf-#,?_z @6 Rp^G50)mIQxs.:|;ü$3fMz/;d-b=24ՄUwPYOqڣ m^ymk^zʲ]:( Ϥ2 8Hvx[t pXGZ@Ep #t)b0Kh,|:XѰXo?/<> >f&/=)SIybS.0J~+U ^\1m dEy OG/܅e0Y t#:snA=@\*q<^.Y%\b|KRcNE^r,co"VvֈIh|C70<[LM:x~ҳF!@(<ajBkn0~ N#Lߪ<uĢ=O~FtBr43\۲!`- %a1EN>E'""I3!;Oo_'/0.A! GXǵ>EHCh|sb,AD:F, -̂n3e6 | ZMO=}b^qA'\}II"ySj=:\E0_z |7ȾP]SU r5_Ȅ5~:$Bζ软T 'J_{4dXS>IXౣa)X.eŬ.y#Ψ-ÿ?yBA?Zu4V? gw-^V^V X˹>h9J8O';l`YyG~ƙ_!5W72NDžXP%ļ-do>6%[A[Vڰ,1oe䌣iOW7Oʣ{q5o]rǮtVz"W<|y y[o%#?ηB }_;V*\>ng!``Rm0"\ ͏z44'@[opG=]gU5hrհ?{db0򑶄x. ֌?v44VO-Qƶ~i}<# I/3 }atPgUr@H1b76#D4sKuƋg%|03= gp Abwuz@Di޳E(E!Q{88IlUi;6c3F!xIШge+5<[qлxX'1GƋzVaʮwLw KapCMkG;Ap{-pS3RIS5a_Pe cx]7^au3Vؠ*;tkGDiO^_iw/cIp+$/zyJyd(Y>u*AiLV➈saد2wZ Bǽ޲@0 N;1+3 QT=J{]rS=|fxgߔvL38{!s%)|IQw)`IC>Ug# e{y>XyjQ˅OЀJ]풣ٶi9R'$ք:sFir) n 0"hCĴL-is1Dy<7jjN+Ъ 7HCԄ:ǖ)|#{'Ef&ݍ֏aCJAw C)O¥̜iR iV 6d3RcϘqc%QfAsO,:5QSO@bK♲VqNu|S~l,k>X )P$ y7$)u*t8 '9OKv2+'U7 lY . $%ڱel uEH 6˳ub+5n,dl c{YrGfE,sbq$DY,HnX 2tEu~ Z(),/.YIx꿳Tn "~5]* {ٹL#{ߏ$n`gńt8~bPv}O7-^SFXV'V8.gk +^x(gH$0:!!#gP2m1ܳ=+Ĝsw@rބ芥*An?BN6}Vsʵ/h?AJN h!gii۬uWk #`ڵO8fR& t2"^%6=}R}ǬF·w[QHyw e^ţ/$wx8M n٢=Z!<@wfx2O[84ILV ܰnyA/F*Œ`MNujš!: |.{+.1 Bz@8TjK+4REy1DYZH$ aVP,ėǡxHp[<+ijF^ [K rs&e?[5\B\{A_GuK7.cg!y_:Hkcw- %%_]+pnjY_o16{РA͉^ `::DL:[ _i.J+؈(xqbtAbi@]`qXi`+4S=5匞`"LFsJj|\JMF\aQc4&i|c}p 7KÃ$sEؕn&{y? Bh3[d tЋZ!4|p`WRgz%`d[6J汷J%ާC[l.0.~]|'OzB,`tܦd)s3fapƇ U+2ֆSs#J;.R{Fg2_$Һ,ރ(: Vyﱗ` Bæ ] ۑGLoki59Rc rQﯛkkt5XݗT8 rFT`v{@ᐔ\RJxgZ'kf-toy2](Ռ35`ҵqrB&9hjE wqQB 6+h +$Q@ndf"]jVbMk~6X'=cŇuM/tJ#4B`u㹟6{f,"%}r4Q7QY?qe+̰,ԾH .+$I٭Jwt*IK#ŲRS ־}M6MG fSqN X,P94)1ULQ?N⪙410W Gj->hɪ?sݵL@nYʦ aװ4_,1~"KWWeP[ ' ƹa.ArHk~Eax `FKO_08;^Z}TWـ.j!}3N~D\^93H51ـ$*rO=!h:@OFKpDI9-oߨVi %{YŜc:|zēC!-]ݔe [0Aޘlj_0$@Q7i}UvL2)swNy K=܏wG_U$B$mL#faoΏ~Ϸ\)9&+ Z6CZg8DF% J\X h|3pcOu[:tbFdvaGOV |0d蹵%# t0%(C(Čko;o}c?ϻJʋ*H".S M11В nˀaQ)OL=Nm#ү`3˲"-ɭ \JQ}QlfA=acf"za2~xFN.Ik*2Mu@^>44nd eiԲy|;O+V9S#M=dDvGV'isuJ/ޓH4d<$,[!~{/ ~bϷno<<^rcJ' n e3"Ps}nNH|{Xڈ' pM_-j|OƾBS-EQ"23C{WLM訆7+jHu΀T̘7"^*|! htTVXbz|LKP=Ǚ4!Eʤ-lVV:Î<[iG+)Pռηjeg L.Α*y|RcpF C 1Kk 'byZ0*vOnNgR$Pw`yib/]3Gl^$F1b|W!#ܴIi$QԢ1:&{CυSPwrֱUEWև?!yp#3 5<,4=>2ض`tLp:ԟ((=Rw31D .ÎS}ZgPA+pݳ `ðxK1JunU}b*YlbcE"Xkd ĵ+^YH7{.)ݴxBA}yxR^eÍ/;r< %c\HU^ {ieWUDnB|+c27+ N;,&ќW K_ceOA9À]<.$=-'z߇p˗]Foǭgɋ]jwwm5sM%Y=diTPߖgh `n-.Tߛ e(s_KΧPcnxZϸ9bW-(1b `:z]^eJyCXhgGPzOE,sXѤDx%G! ݫFhPqJI_/oĤ>^o16> j.2 .\/ *\F^ddnje&GT' )$,.NOآԕnejj; qml詇s5Pq(J,f,6R^ig5LaN;i#qq@MI1`tQ"AW>!W|F勼p+d̈́'޼0a~yd" 2(Qw8 S%@^ (ת43R gZ^X(\Y ( ba,ע#h:r)t=44C'Qʴ%j@沈Y$9ĥN-v0*K%swu{}VcLqKq,E<[ӽ#zWq o(;ѷa> ΤGC$~KW Eq,V&TTLp/iIaon1 ,OKl<}@[Pфp;JןW$RrjA$RPjU5F>pA7AED?9)7z @%yHUSw wә Y =r?<Ey jgm#ɢ4HD;>[[!Uv~E+F-W:'(XօNYe|*}T֪'7yk7V{e%>IUyST~L_>uo\R/AzbMJA5&tTokIs+MM%դCh۫fl$1~CQdЙ9Қ=N1ӌD7@5|&Q#hѓXvq) `,ٶ5f{md}\TH;pɈĮi=iSqM[;R&½]-UvSǞEIQ<5=K"K:HM`=$0}{ Phx>uqU @tY?WۧjwSC:o4ʥDGP1W ߦ+pXkOU5naS9 _:G6JNΚnD1Vپ}][1L\蔕8ulGR /PW$ﾁy d*e4R2_ ձO=; q!2+KRz]Ѣi'`P2*=9+JՓ+w@ Ĺ^o)tba^|jM1UZG%'݊V 0k4}sg;؇H.(*=C̶^֊\(u3cR֓"fMc}ՁLo ʛaR4)S0ϊ狵@ǐ$-%- bi4gS}+ڽM[Zr5/0I]3OOOK# Xom/k "L УO\bmus6 gK&e7 w%.ԭ_ Xf0˰ a={M<&9Æ(~+e Fp/H+~]WZT/^T2ɵJ(zsVւ nF[w!_%wˬ^6rP;QP/riz`"KmLL \]zs|ծQ̊8ʦxTj՝q;sϣᢀ7%Ur)T) z2z; R ,>1"*&i9h*}Ɔ/1{d}Ԡ$paX7Apb\UCXCdEy`%} })oxAo#6K);oxCjΒLD72F&e}b# v``6_,4cZascԗ4eͅ3x%aP'6r%fUل+u-y P+R.@S@51'3XU@A8ifU#:03@0! *S퟿Lz& FB)kx53ja%lԖB9%*'4KE\ -Z+1a(#x}%QCao'A7TAo)`HY:i1#qPS$DfSlZvؚs&z bNmqO^ΎZɹw+anVC-{9/\ވ8",bBBj5b_x^0^,Jt- f`!+bu,k&o~ϢY9I`bq]3g[vN؂ʊbͥ{HWh@qwQetQʾL4l]W(o? ץS~? 7"tq@p%ܠLM#[J>eB&Tc_`{m3C,ʦk+ ?92/‰_Ih{khf]x,0–rt%ʼ^}I vj;q 7LXPj d َI|̓Fuhv A)&+^K'Eگ"o^lLj4s1Lo'Dj^* eg65i% I6 jBboAҘQ`iH XFIM+}Y2kiM5)C%lO/Mϵ0K|0ts[2j'˕G'9yAgywR.q>?uK𾨤>KJ{ܳD<3 I9F=ep;@ٰyD|@X%p) :p$h8ڠ3I8 (3YhuW Om:jAXبgCׄZ0މv~ qÇ{8d2wxCa)uUjAX--Cr!!ת$<+҆߹#0Wf( X}tTNX:x^~'dlܮTo:T  ~\(>IL%Ts^yL*03+IlQ2j<*'~jN؋0M~Kxd-\&6{9Cܢi9 U}!RBW߶[gZ8cZ[3ynt7G~ߔ̵r v1rz0U婟j2ȐN? f K66tޢA$!_c㳵PxGK5F ɉ5r(BRViq1k/gts^ RD`{A2]s? IPI.e~n. KCKU62anFэxQfg XV:L=N+jDB 5l=pwEVA*muい(yuPG}+ D63]ע}opB/_p=8Y~ʭDq Ey6EA(R׎qA!n! 8EIS}V6Oki7(3 S(/+.HyGըc@Rt|eA<ݻA,[Yջ=dX5Zi͸blSa h,^)6֮Lʻ/M1E~LjD`wH,iޅSu ZÈ$yʙ.~_Vt% F8yoê]iGe\"ҷԪ}0{.ŪJJPCD˲JO:Vɡx~O^]4Vhݒo:zF0 }CwfX Ѷߎ([vq4j0c`vD CDzX>[ޭ%3 X?⒱lh0.!y,i2VvhX꠆j&h TPOCMo,oԫ:wٚxwqB[3i~BD]FA`ȚP{n ݶ =HYGa{8`ĥ2KWDz6"(W[A,c !$g$`jH)CXwܜ1 ^lvf~^E^mX}/cbh^H ځ|kqNf9xXK׊[ڶB0|GmV{ぱHhz:w3hj{C&r9ȿDGKdD 1hC-Ld?ftt̀MVE Lr)$XC FU' ٗ׬ڠk[6z>kt.FM 6:!Z8Zgd 0#ddQ\-[{TϹͿBǎ3_hyL"Dg@sDgxR,@8kPPUQDb)$HRuc#eZzׅaPp9?e5c~2%u1~`2(=0t(G+BC\R)琇y zx-:y 7JiJ'֥ĝV `4.l1ILX-v h>^b M bJ=ܶ;+#; N/$)([rcq6Ә FÞL_v84f`-6@;b8_tz/NکZ?_6!ܴXzm#1AGGCxo2Ҙ~D%,CrIҗ322EF.'!剽_ت5oaoɆC^|31!5^\֝bW ߳R:>xઘ@$R4BזCC \ӈ!֘u3SPr#'"jQg<@Zq#-HZ4φ/R;v6Jg80C,GPד8ʤ^? =0T֙aJ?f`@x~CZ:NX].f먦l0ŚQg|°/j U`16Kk(5댈{rs3]Lq@4_\"1܃u׷3KJpe΃> +Wbݤg̔I! !4(=Z 옊Hkٿ\` Q )WQe [1p  4} oqKz1HX݃oەu<=7oSП>P7'pɳ1h#SS&J|qCocRi ++XEq%*N) |x~nQNlF$ -<;"e6 xUU9rхXH\U!.=w{[Zi[@ctYXrJJ_L Y"gJ4F SN-T2XdLܢ05>䕒E[iۑUDDh..|^u,叵wzKYޏonI6cRa?S+C\?u5ekȇ~Zֶhɣ.|9>膭F1{#Np''C3 WeBmTĩ&ˍ<3b/ jzt;'Q3];vL+~c(GY慬$ >^y?~%fmǍ9} 4<;k7J?Mݴn^BEU_VrE|jWm :G݋a>mF*q-4f2bTXuGKѶ/>.;x}<8N"i'5d۟BE'@G~X[\x)fH-2œw]"ٱ!Olw\?Bf4wx8jϢA>|ZTJ2.'3 hq nǞI.'҃o( #vQVx'19KB^k3C s#MR2<ø,t4#h|WPo>%av]h7+à 1B+2;&_".N;l.msv! SAEW!Ii풆aøKS1*`k|n%N7Տw8\h4WTO~uAd7Dwn9 rM⤥^4n\[ߕ3ݕ O9NFk_݅nE4Ng]ԣ N *dz~&H^8XG(=-Q_#b(Je/Hi9 Vs#y(Yl7qi"^'g+MugY?.R sFm՜83`0.)ֶXy8򄪊d=.~+mV\2Vgt"[>SsX01^m`Lõ;ENF6`h*K[nߴV[o /k5 Zu$?,Fb_-K)?:td\02/ܢ ="}Q_ R7 حcf^| - \6#sP ))s =/D AW˸Sq,~]z^f^^ ؍o!jVd\,e:ButϦ+3b"j*^%}/8Q,0@20tx~g#0 K pbuj%8hf^qE>#݂aYxcMOk=mi pȊuc@:3f ھC/ԏ ;~FxO eyWs/ Ě*QX<:n9$ *RnrB%Ɲ"=r(fޢVz\:3|Js}/>^f!mz%΍VgAM[VmuQ8c/g:6=[5|>y\L?IP }!!Q3>w蘈;JP&Z["տ9ktc? WIm iz2,|HAunv_ى,c^зJVe˵S1]EӥwP~ #QɟĮ6G{q0Q (h֘NI8Pj+O]b2ʤV47}9.UZ5#Ge  RSDWNw u#se!6JA(m8YMI0LĽGH#QɛA14& NVXYRNZ L6_ o@I)\Z\7+?yVa䑜'sM;gZ0r~uo`Ċ686n0Α;a/z.ǖzP.ITX1ЬV$$HUKgyiW> />"ztҖNN<{ml{:BPjθ,@۲<&UoNr'^`5].=:(^&uD?fU$b sT<4vh͑;O0|d{t6M@+^3Ry*چ>A\;D Ғh8rUOޑ*gu3hp1I:H鞥ERdOhEdrPTx)G[JQ[Ӏa}gkXWᠣxҙ⠡51ٓ$f]hZ7)TwU;l`܇f8)tte6 '2FNsN+_x[ihfՋ-:Pѭ %Qk@k$0P]xMpЕPb1Hzץ> ZjaX%r7 <ߢ9~P8Y]r-!<2w]AKwx;< "E?F8fU?q? [ I+/gfa(Γ`F9tjQV Yn a'A=MEInK#`շB"W /3Z?|/!vvDIbo9&¥(FT% o?B6:vAݣmk'j=R 3/\)^c?HX~F;*hY{y0El8ʆ>Bie6m9NILG"N! wwI! /SvVׇ1G}Myp!')1[|e$d킄|ݔdې?tɜ%DY~\Z / }-w}]ŒZ5.&ucAo*.n.՘֢\hlEp jՄ" ztnu}TANޙ\561 Zx?x uMRZڠy\_ ڽa{Rs{ҹ CRKsLH*[HlkE_5~:^= la qFބ>?')}'-SZF#|W%w铚|I^WZD͚`XDӦ(ckӞc\Z :ijK#AF1 Ѵ[ mK,AztDH5[GU%N:t$NUǫ*,ԯx *\4j梏8kNʗbA|wT^-7 Y+!O7 /i/6j:W*ݑ54XdBf.䭂eF3:e,iߩM|MYk^dKVqw>߇7U|FIa8Qm G/v}$Loduqk"3;;cbxs R[[[(FQ OMOֆm+$KvO9dǜQrsUTYAN$ k[-Su<&aou"-wv\K?խLL%U+{'2r83bbp{ʵ}dr7eJ{u'%(5Fe.Ht_N;%wiS?m`\i+P[1A`ۃڜH&OB Ȓ OlixZ3AA>A~[ St2cL(Zוݰ,M]fcʐ+@ d{Zgo8l3"u.?\ZòwA&ý ΢'(`f=\Up pL|xA\Hॢ40V9~PmxzEMxT?FM m2cYA9!b-8`ٖUʘu{R qG*,T>10SxPP/tbӹܕ(ks58ҏ{EB$ FQ(:Vz⎮z؀eo04~z6u?|_(໷ɪg\q;]܅h/$k0}8v6 b;_4 g[ pok˘n Gl!@1J0XHS'}@va6?I3HtbIQ'fIv! c#j X8.բJP!.YEIHC·*Ce "7y 1<@+ <=݅|/ *Y.D"aS" 0ϴ5w}LT"gu g}0 !uq(Q8@gĬ> li#[]ZRpXH/Z,U"`&Quör2(役ҙyP(Vp%NwJs(l>Fj^фbq+ |am"z(`waMcg_trP/y:\Ł'dW4=7@*|R 8/u'qy6EH9w_'pD\l/ `q_5džjnl\1K(# ArrSǏgF8 _y~ 1i#Jj3k-?`\pPPLZ~ [#.4sMw0|ԅVF ge21E|Ћ<E`@=@,cYf=dSUqֲ3:(Mz3Ab%znAC4qM;諩} ', g\ʼnܐ;4sҜPGS)rs= yZE\{KxY u˪2.o=kpM7iS\ѯ")[& >9[5v C&{qؤDuw3Sޠ) ka.e 3mn83)?CXjJΠ ٨Er7'~..k"Aֿ#;*H=&H-(ZܒT6'V*(np:e;5} F?r>SMN 7hsON.is @;7?g➧뿳^tbX01Aϱ>\7-I(-{Edc 1)۟aA.@ Nb`si+S)*Mu$A;Ɉ5cʥ{?N1/ض"c4qs?>u,f"uWHLYW)? ~ ֣358*-+ ; Tq@9C3HR~y*k(2h]a3C֑\q| -r OФ ^8nzتrxՓHxS<a$)0UruONi /{`#}Mu"6 "-RY.Z쯨=,'eg.|p)F>"Βg SkJ3sqiszic#2_TdB\.qD5:a.ןC*5MҨDz /|P!M;!Lh (eCHW7v \ M[Zn!}jZ-14#ΐzM4V=Ƹi+l E4F-!u&Y AH3S.WX:Ṱk aDv,̐|*ögyD;8z0bSo@0[۷ݱ6b|hodWӠIK[R/_O[\JSKHY1#wTAmW ͆M;$[ 55U 2O4)Q4ٔ'I9'C4@טjHmx|>ΫSdC׾I;–ixGQ!D{é N%1d덼#%~>oȺ;[ch|ECO#Tҽ^M<=&ۏ[N'k.%;>YUm߄]ÇN6;K 2xz5S1}p@9e|XXV N7Aj:B PO@~n7.#Å>_$>r &>a,Q'>5|}$ޥ:l="MؐrXOI]|E v}X J$)n=䜲 Ǖmcd"BihGTyIowBC \4 ' N-2F@6f#^~:n^ &+cOYG!j'Mdz_ oM,u(?Ó {@# M10eC".j1D_JhFҷIĝʡi Ѻlw#$/)d@hjw-*:m$5?y6G(&;IF"b!leJ;ųh=}]<("jh3=%TCv%`IXZCHq싦8 atJ8@Vw8=hL ٢De-̾l)yLsaزԞV<iW,b.'hPߔyc D0Y m`uj5iB/\F~a_t@5(9rC.\UR<;] "tCopI }3Y-Yu~/.w0k6OOI}쪎@5u̔Xf熘)i*GAF ZEXM-/#&ެM^ub7kmx3 E;UyCV6iG78GEY􎾨Lղ{8U}^O8im;SjLi kRQQ"Ub7DvЕ+ϝϯ4xvڗ ZV|pN" NHP)9pmк˰꥛0>!KuBn8ٛIޤ8t?k5HPXn0͹:5w%b+WhIm[b 8j{'k[9a Ж0L&\24.hQI꺖tNDAc0 Ytȝ>zA,N+gH{ Z{=sY=Hdz"Fl%nryH!ͬrkdg 8uCm,w6ߪ/2=ٗw5z>6GP sbH%'f'PJnUi$!L4- ޚ7 VA2(Bhj;BDeUVf5s=`F+.kdh~[fzE.h8|4O R0G5l6lLv=#`G]| E \r_1AQbdjדoz'M7;sz XX1.! ICyS a=e 1j?ME62${]/V*`k>~2KwcTMBH qeiHzYhe覀w |IiLLRJc3'1u0Yw/ %E2ڿbͨ8ƣGB?sy(&$VxJTjCB:(e(#HVMJRfU;ޜXl\x̛Z f:H)qBAl>c«N@aw7!7!CFu5(yQe|a,J<a?C~Mn ^rJDs@z|uP?ր}@йF5M8NO\VkcܛhD8e$e>rq3?o:L\rۭ/V0bw:}[ GavY5勵q^+:T>q[ԣtbR`vȎ)EA}iZFPD~0 XKawo%{W#6]UJ'mSe#"K*գLﾐI] ,d۳8 f SM7 s(fYS&{8տк{VʋRMS={Ot-fl呃 Rq҅|Rwf Vrtϻ@l˚駅UKD0|ԁޟ3rVn@ժ SpC}Ŷ-Aεe() )zz&ʊ"l2,U"0{ٖFu*pO+p她"9#C {Ζsi 49H_1zEQ$>#ٛ揍| \B`RԾɤ~mk&K[ LʸyZnˏB_G0 >C`CLX0"&rt2`/<\&9*?Zt,zZ##`gf6=5 Ҙhg  @x s V\S, œSk(1>~~(EwlH.MlJ,3mءIڒb }i7cB~U#GE8. E|!8Y}q8{^dgSAo˺+ܬT3 qa5<=Nί a؛;F@m=_S>Br9CL%PKdlm0?Wj3) C#8X~I+W9 :UFv+yWQEawV8zk/˃_as>C}dt 6Oĉ\:X K)oܣ+u7&=#}~P×뵋EbqH9=V﫛xeYY`=?NdyH4r V H8_O?"zhsJhL^r,"haF)W4{s;3k)7c8v@wg_3GuU3Z{X9gz4oZi(p1Q%o$]O\*`%Вr{ /Gf_鼈 RfW=.= w GK>ybVn5ĵ[y-I(MP$4Wj{ZV◵kbMu2kĺRM_mp&6d䵉X)SYcCۗT:7['+a@'@f4oRb}^FzoOKDS gS[!ؒ_!sKmKrhZrx ghBKu1kNvcm0#N ҥ%N^?zeDpS?kIz,G 0BRsg%hMH,&ƄWUM!R_gG+!K}еbJ5xs<G[Gd€ |498]zZCPB-m/&ҊO ME4VZ̍ޞ/n\mk|Ewꉲch^O:Lޚ"Wz򩷾sjlTh_[W#MuB!mމbKnd%sP7"A"=$5*%~rBZQsUsfz 2D}K~ܢ_.mןK0M}H$GaC5Ҥ,*.Ҿy0 s#`ݎ?KDs`~(@)iXU!;rQ{:7bx %|M3yӫa/0b2T`,0?E '=G'7倫>rFy<"Νsjy>NBh3ɨ6ZVGሮ%P|Q3<_q?]Ge \ ?$2|^#wv.@˫Y P@` B?ƶdC1+nr(TDz̜K?st7\rWKm4:2?a? nDN(h;@%s$_t (3iZV׻EF9/82`a~(&`VT:D&&{.+N @2@.MKƘߌ{:7@A]r~G-Ƹټ18B&))njAbnj=p2 Dp'Ct vr *<%`lTNF%Xhe57X9WzwbO3fNCl|$\/(ҳj2;c">"iP) ;cR .5%70Qߪ͈'G1GcÛ%/DʌݴK Hm6"UeQ:/Ϊ׾E/R0~e$P{C8zCSo qBTF@_bcqyu@Om;^К#:džwP1FWvX߯4DhǮ h͜)Խ"n0?u8EqKiO0$K\xi< 4[x~e3;?P/WvLpO?ã( y OEKWiWƫH&g#c>M4AZA[G% "*2BT*TJS2VSQ ( |NtsO-yH|X .B )'սV*;ӰVO- ܗXb2JJChge[H(c> #B`9/߱oH|<~:TIm?|1`?v9d+yn#rKE1 S`x6Cu_\py#6Dc/Ww?n>Fcpıxo7S й.%[{t^Obk'+ !Acg p4*oWkEz@JRvX&[`_&(rus 7U>cRr/ehnax J}]kTsk4)GۜB)q{NL~LeJBWBa$yXA< 7_x 4 Set4Q}Y=n$;|GۍI;64V\h 㠽r*^MѠӀ59;&V8{=9g:Qo̅&~3`/_Ja3:~um8+f% ß Vޗ8XQNy7F5S9\hD㞒lR7pz*Vf `F=Q~#9~u2Jئ9WX-lok_%F: .4oW 5_jc1^G.m¾3uZiE)E>Y3[5*kbOhjDm`)) .Ľ[N #a܋ʋGddo;]͓6lL >3j`E=!8DLštE{.^ hDcRflDVi6J=X"ewpxl6E#%E> n[zY\r|;xׂBI,x@PKoD҄ WqO#(bYRRD4ZM? |DlX {i$ؘ *Qh "?Zk#ݗrՕDj$,af-X|Q4"$ Y{:.uz24y63R ,gh-0oڳ+xf%JC;9bRiÄIJ ʥy^$/*-Lzmyܵz;| pYll䨂!}6'Ll/g+n&e&JOL\nVA(%Xq{97z狧"8X3迠e╲{«ь;0 hu>'ڈOV{3"='15_Tvscu<?^n=OEk7GZOK67~ S+.++;_hSVBQαxm|WL\ }I' 0Nw.s*eBT b>> Of@NJ x#DB+0nts3G|̄n<@\amxQɓݘNԉ>rY 31dF( Cƽ3G(, {?L'B{[YņE4arR "$Ye{@d'Č 0 X9LE>ZHL*0}'Dzz }_ymh1 )96eP2ϝQ5@eƇE8 B5X?IN+qY h ˸B0kFhtw7؋o8ͩw^DH)pZoSiɁ֟ADKra)s_<-cC|h E׌mٖ΂X6<%/n4ß<=#@cXmRi)z#@'BȻqTJ@Nnz*Xu,\Z̸Ldf%y ̤1_'Qc|ln4([)q4mֳϯcYKNrs=ꊴ _ę,n;tl $.1Sњ?6;2 8=1WL=VIoɁlXҊ |{jI򔍘d؅`}t&ѫ<fo5[K,!jrwpνqw.S]yh1<`aziter7aOIbX bFDSoX 3xN#y6:b^, MRc̺lQy6kkE/6rDsdHJVfmZH/ඉ؃;,pWg|fnubF@5ĒKL1'%}wt|c|u@"yGn%h >g難}9[HSڳi!X0a`T ͅΡ+!gⒹxpLa Ǖ/S.'8{ ٿ4x[a\+95;7-fI!Gd QOgrf5xS>/ \_ ]vB("P(EN )-B>kp=$z |>3?JBv߆b}dGra> ]g呚:;=RJ9ExgG1՜ġ9T~g& ZG?/rh{v {9-:Rt~ASڙfnE:bOJJYE^, D 8VGiLFvam%'UPwjffQ!jE%ur$Smi⦗EPgWoMu.!d&_ /x8>JZ~]!8^@$Y;wa[U1Q˖v/"w[BZ.wS/ ZYgoΦZ[hcN0xviD5Y[AЀ KA44\R[1!=]vDir&/J_e#_v}~Ȇ쓌[`O2C3RK%ֱOL_~+PBFw95.r"f,šFG^> (c+;ꙔzzZKNDFp;[{Xʻb(I@8.Tci:f5v>\͈11cbǃv*ocZ׹FD"Ȭ#~T yqZBs-||O*Pp]EAgL~~9KF"ԀWp_>XW)2|..^9 `JBhsYw|iU9y{ h|0З %2N:&vLϜ:\?.W[W*${8 a{.3/jOXG".G-dL ,qoIvȿqgA4S>k\W(/ +oyo]r0y+Ӷqfa"ćdh%$qH7J9u";U{GKiaBlP/eN&dV'j.W]qd2(2=cvhwMfamk1- F 4y2S[6)r]VQՉx_MsxIO9R9cNtmOhNs(2αO|Qw? m`8 o;茋a6{8kA-a%ɇ:+Q\0~uW_(g!94ҿIhK';9!p>2he/US4#c>l t:-B{[2־ f 6;㮍.-OlZU]RIjⴲ{:7ҕ&~P~9Dfd33?˰su\s**&CIA|2i-,~|2"H쑗+ϘU#Pc+V2YL PXׂHG\$($y2B,\4}F=\k칱\ĥJ/2L9yƜH gzwc$% NFϵj={`\Dd;JSB7&j\cj`Q`M2PD)r"Zhч}7\$g`=F3_ZIBA{sBh' dKE?Ʒa$u0&mlǠscL;`qa4$Y+&?#',lּd88v LogYIZB;M}ա*UQ],'{ڄp'fjJZak[]ٳ#k kAҘHǏHAGrzDwK D0dD:ꎨD'F% (i; ¦.Uy'~5l"z,0*ʪ5Y GDʉ2Yψy37"f6rS7z RdI`kGw!i^]uo-tP\3/ 4K:m&w~iGױ@Iad8K嵰nmL T͓5E_n5 bb2_wBbIZ;Kj%4/o$@W\55Vw\Yy8=U5baI">-&qgTVhtqtU2u (E|W r!O )\fM\XxNPgIR"J\r݁+WP~O)HY`` p >ghVeT) \ nYT$ls͏tñ薺p{%@V3l%?GӀ2 %賐V'.7Yw]0V89-MRGx*jEd N\,*'-ITRn ]3!, ї+^/s1^YPB 0Oܲך&qXg p%z*NNU.<ǽ4QՂ4w,]Y#db_ b?! |e[iPƳ뤊4 qWFfY-` pks@n7]+p~|$-lHY64\ 4B7"Wi}zcml kr85g _?wc8Sbp30,t}!+JĀ#b\ؘ )t@\x'&M) &O?j?FbQ3Ɇvi`Bl(0W=TM,ė,%!&#@Ot؈h"OdT\i*<.ߥuām칥9Oɼ a%O+}@a1 5\ۜF)jWr dz,q]4fJgꀈaS?$KՅpCJ\^ ;ccPɻzS~a%Nf< <-8[U@ nC|I8Es^L ME 85~΍XW˔itr( ``ƈc7>c2x8'19L>tt|!nb #5\@҂JejDxu+L<֝=L< kEy6qF:%q 'O?;{hZ)A 1~5Z౭?I7NQKQQNL) d'6;̤Ά4eBDM<{Eԍy,o +sEv=rsR#90cTL4)lS#(V|H.X9q9^{FnTxnѶIzDckPi(*̀QZJ4|շ 9pDgA3B,kl)z{cR'V1xAJ"c7U)\OD+,Lt]k2M-|'a/ ?Tc7â愻jq?[)l~I $KW}:GCː HĞ*w(Vc= 6a.1— P\j6<8 9.(qzxKxS>T_5KhSiYSlgd d*0Զqn.úǀ@o  I(*1:"8,6. !zۢVpd.HsYd_nc F4T,owI ȈB]'H}>\@-~`ȶ|E(b.Š8"'#[!b$<Zl^e] Qo{ 0]D}H&5营 ͼ#' Ljqdlpkbf2 cⶭ*n-ձ:$YQ@*>x#O;Hat2)h`S 615̩.Ikp!62EIs7 )D,'tU(8X-J'7zm_5pHlOde"f`":d)5?aŲ+;!7q8U҅qCj ri `+ž|}|H'Vu蚹~;_FG7nG^L3Zi<=vu̢Xc]JdŖfQ;? mrmQ[cU6r/>WV=wUE{#aXno֐kG/&f p[_}xj ,$ dDgSA yaL "+,9uV9\iZ`h g BӃ6oadh}pGpz,#L;.c1g}j~o=]r7BuiaI顺SIcn%8߆$m t #Xv=1/|χxrU˸( {ly3~hd˱>ܢk@L\W&PsybID6 P 8/Әgiz<վ g۴@)4ۡ#`{Kx@շjbMi?8W"" gĵk#&)Xe)'RyLMVYM 9ztβ`X}}5VQU󥠵r#0N#d[ W5!s:c{v<]z5_l]ybtN6S{PzՆLե<<ȪFr/ kczLW{"8ߨX_X {m)n}.9g>!B_辰K}# N} ̌"L?DU(fq>Gβ4oggnUUQA;^mBrDt+֠a4G*vZ8}Zku.E5diz0qۥ4q2m/U^舺&!qM3'ȟiHCQ 9lœqOvbD2yXa/%|*Ƒm3)0Sͼ*8syƜ>rZ5!ֳ Tam.s3l!9K3X'I~ԏ%&v]x(N YFMS^E7 : 眫ZZ!1d/ZHL\kzCn+c 2 F.LR5G gkiST"?{RkH1Γ~jGqKٖDU2Azj>sC:g!ZbVvD[{lL_-uzuZv|ǣ~IAȂcيv yGl#"FX_SKg=-tuH kY_@<cVr5_dWEDf3?ů;rJ6]DtkI␐oJJoPvQc(y&"wӥiG  &}}O*Mز Fʂt1r_!sRB{qɖۈ_g0?(J (qNy,# 0aبvǕ)] 94 ےbq4 eX8udOWφ =OYhju[aԮip"2Jx3KtŠ݊]|_9]96C,*oFg 9OA,*)cA.Jf*J:{Ldq=G%"3k o,MڙA!B :)JmENhAhu Xe*;՟i/Ì xkgf:͇k$~"KܕlԚ]7;wSE;3&s3ݒ5+'](^+eZ.6V~꓎ [82p4g>6\.T:DX^VPVƒ "UUc{@Z2~޲~wE]k˨h+Lz ɏ lᬥXqwmф u c4CxsO.2ߐqj `qGJ;ՕMZȨPjI!-Xg AD4JvVc:]N&͈ Mq+?E1ڭ( l{M&pb'Wr%ev-T?k ƜdQ1=Ի'SCI]p18x@O- sKӁ Dq< C\t?yR#=BI .&ps42T.*|v}.^GVU+DUJғwk}sY{$M!E7Bۧu4fl1XAOSW$6m.ߍDl@l,K>2E񇷦VJ.k~ҢBnTظF{B! pMzNUbD_[+dO::t.K+zBO _'kԘ6ߞץʕF$#2\ov+tKDo%gmV;&Cv0|o |f@Ĝ@lwi\Co FI1Xg'u.Q CЩ\hAZ*L]#!,^7Omj㭴&lXӟUp p/xS UL|iOΠ~sbcr0PK/iUR*\/[12ɅHCo-$RJ}R9T)*BXY6 r(.L8u[ €G3j ?L!t߱ (UGVy6|xԡ6rt1,6B1xfp/< "$|"XO*Tt޺M :+ڞ[xƀQqc8wVn4=}魮8G<)Y}7.Jk5f+_;N3xZ i\l *ADZ f RwءAau^|yK$D>]oo9z-R?z⼆m?뇷oa3ZhɱWar5'5n7e %=´O٧F~9_17J&c(0/QӍ_Kod*;}7>1e`)4  "8OXS! TQm:(EcL& ,XΗhdSgOlL6&xŕ(E6GƴNsL01AKAN;W5+翭p=On.,4I8$l #1 p+OsT#С(4[ׇ<51,u ´bl UeD܊2dՒ(~.6!xl31pBwk?h]a uZ3{WLD# 64UL6 <HV ˙'(Qs4l&SFz4fSc]*kԑY4@Wu(p& O׏`tNw.9\Ly4ժ0sRGxy) L0'+̛ N Ndϸ>E;؊˚LzoPD+[ηެXvAT BOSYsKcpPu J sizE6()Bw/i#GMEJ_ZkӌB`{mOfR}"A3l]èJ]jQXy- J]0%\j-@F3cKjj~yǺ7•͇ɶF)G,՜ Vߙʅ{!ZwOͨq2Q`C7C >Ә">{TRuS MaA%̫qOS_Z vĽs䗮ɤJ-7?Efcf6:ۊB(^_*RBvDGr W.$,Kځ sDkۖްjenlOՋ _ ?dg4OKEHꙘ@x)ڡ%uȺ82:R!;di'ڡVG0N4/6b6.e98Z{S}O-P}DdrlMBOWewyTۓ̯$) Ŏ%;)HH߮DtĴÌų0US>&]<JjeX а/1b1ʱ\{C!\: DAm>;Etcѓb3vġ7Gy?+{'P'H>:ſ#xy/iMo4m##91.rϿMqԂI VD >w7!QT'˿zTTPbIOxV"ME hqۋ39#24/J'P @mkE\?jJk 5MS$2/ 0sz+%  VYREu`@ ^DF^gp鴴Ms`kkWB/y&LeևYiL5KpSǃks:ҝe-MT]\#R:F3IoS7 ` jh\;NBj,}mc=spmNӋd~*əhgϢ˰;ᗃ 2dU83u sP2Ãr?z I;g̦K;l )l2q;II_Szb:5SDI5-e3EB~5'k@tXBz rxwW'Vc{ uP<3LKB4a?jwUMzPh }#q1 П8Qhmy(37Au), gzICi9c&d؛U PoI;yM90"DJGMgv[qײ1pC@ .!U#kn!^5Z/(A Gqj/94ߊ?el+*3BDA[mdzIu-(Ojt~Q S!DXߢ`*Ӕ8a-ezLʁ>pXZD a rJ V>*\5k(vN7¥1YJFK.*3YV'n0#۔) _K6%a8x]D3 Ϛ%](8C4B&a;t` !0U,Z;Q5qu߰3 U(ei>Svwoi/CFŸS藨"@"_HƝ4y5m:8kI\pVxhC 0W1 )J%4)OBf7uLOuGf& 8Xo*<`!6Ϳ֔]4ge0^is1Whv !y݊])2-ȪT Ƙt߲~BPwP4-]87ഇ=wtpܚ:iZuˬ:qp.h^/;7x?\sB/8VBAwJ3B94MT}a9uhG yu5ԝ%iښ` ³(5+|O&W(Vii+ dRrvҊiH;8m|j1Ep3ͱ ac -p 4?V^KՈ?k17 (4L'kOdy":8^!~2#2'#Nnŭ}l;Dypd`GY=H&I Hz~<6)~FޘvX)IJ|z#( w҄bPyO`wf} ? t/R!qFadTT;|I/_|t]j{q@IqWrp[?~]C,(v jhndeώ-"lcfh$7L3[%d]+`l)ekq* QIY]|ݑ̏< -j-+cAI_YU(Y(nA$|Rb!:ye?>3jH 0%YkhE+ 8!x;?.jg,䢴!#f^gs j=+g \/cb#.r'y)" wf,#0js´KGS̏JIm@']XJ7KUN]+ !aDdҾ ] A+ SUU3 "L99yςmn:C$qH^FbU_4K.^':D&2PHE&‹&91`jz I|&L M+3 krvx-)_ΕvR{l[\wE&gn'Jkg? rR4>L|u"i=o&'uO0NdHcR@ct>V[(RƛtlԮ8YVZ&1&[W#c .k뮣iZ0}X>lL0we,]d Ha"@{y4&% sK>NF?ԅ =)*vꢅMS}EUA.A0#^Ψۃ#${MY@H2du~[,y 'mf="5HP⦘? K vq KZdɧw9yL6Gx.s|yyVĖmkn u l}g *lpY{j#@;ďE;F/K{R{!eRdm]2A-\Vs~En6~r"G4}.[2Tu=0jG("lw޺re Z"*([kcٴ}cKQ8 V{XK |߈#W@+I;/W֠\F#oӍ!oK M1΂4tĚJ\ߚ =9OC渱d9܌tkd7-(3P^ʄ&`Y=j߃`m4UⲆA}!Oodee cH>mV ˠ@Ji/=%^9.aA%a7$ǧh]p%(1ĘTl.7 XC*!ETV-&CIĘ_jݴ5YY$~Q#٦q* V Knj` @ YaC+]^F^&v~"Plz{f8ѕ|ŋa K[n6?mj$״o$r/cρ3Z}LaNWdscO ҅{Y t8Dh[Qd lxNoYCsKgh2UբPx)BuV2ݟX@]h6XCN7b2ʮ T.9,:]V1 SgB3n y<xlr' 9F!]fK?/clG+GQ|FBfC|tX:$r ?V Q\(MHԓ_;uP?1']Sej*oһfs:>Ǿ~r&/BU@"wMM6k)὞{TT]o#@ {la ;@t@勼<pv^Ǻ f((q.[/#X)>gV8jPhHt1L3]M AWG$~%*p!|:Y_A\6$a(28yx= DқNGa pWvmi.^2'U!,ذwFI:ժ\[ A.e6̏*x"vkQC_Fѧ=v$`Mn 23m$iTeyV͔l\'7r ǮWM4hrEm^Yfypt6/وC= "|Ҍ耉rAHDI3B)>HoO}v)Ƒ2@^P-G7Mm33W[Ĭs dg+[@"@bDxAY !e7j_bQ}kHU\W4<Ϸ1/d D\ o~9jЄ:q*h&m;F49I*K Hت "&nv!~/P9ʮÃss.~ C&-~RF\e*$^^*/\iZ|xd|A)@T_Y.ύIJ+6CO_)^>DRYj?ÈK̙@ EXa{be1y֔6իmJ rd6EePcRDDgЖ$ \,7أ1OY> :sFx$S"> t{4+@+s0?"Q h/іYS)ͱnm$}?WU@I3h=C5XV%䍟vIG6&<:~2LPH"L}lܒBL(CJIq dW j9u YCOQ1+eF^k!Rv7W!U5#NvBK`؈~o:aQ h99ނW+e&j\$ATDWٓMc3jYһy`\ zILGh,&91"ĽЋ$zqXb mub(TW8"X [!€3K|TE'vcΧ/]%*__B0B7P=(%%4JMWN.5iū a3$-fn%1\^k (r' <ta՗=Ab[@bPYĚs@A.7,eN%+`6A&_=}luAE qq\ nժ@b ^yū,֨egN3|>|6pn0Boy-yCn--jvX{;{\rEᇦ+ Pgm, !`(P* cXf9Ц!Bu'YR ل2a{Uޑ+*jB~30iW!ʢR:8$[0^7ωTxb]w9^<Ϸ'~G\#4=\gPKAjPp2CtZ_c"`J)d2o^'WD֢ ![ 0[v%42?|PʻGwO ӎC|t/3B{!_XϥW%OStKhuKj4bzrjTUe,ئ_|N5A26|(j ,0עk. ÄyFu8fw8S+Kǝ&wC茜{A$`A̱99 !2Lji l{IF'#}ݿIX%.4q&W[ݽ%(,e14҇W|f*n_,YzGuCWx֮DRPyfLl{R|# R&*l*TzS#3tb"7򂸼|QvDʢ6>y8~;K7a:O{ap@`ǝ6˂.>!6Pl62wM2FxX6)[ZX0!QBj t CN.{L9L}7y$^Pڔ ɋKi!x'Et3~)I"3 @4"OC2 ꚢty>P18W̙鼂YlKW3Σ߸[O򢧠wmbY SLj5Bܣ`NKR؋[w䡓 l?ʼnR5=щF*+ʌɭnb]Y\sZ[9WsI"A}DpO3} i`X%Xi Y B"PKYid8KN8@sӧQgX1]g<(;d Qvqbgs׼ds]jeGVKm._.y@vj"Cˎ)k?q՞狑kׇz4C|Ͱ:ݩax2ff#7Uq@[Ֆ;4%1Y-I-B-A"Bk=s΋aTMl$I?~* 3o\)FF7q_ nsW75OEC b3=1R')# OxĆ!=yZᇜE B$\;kϨHD8,-ы?I&i(r;w}>hD4Ӑ}H7"|^]ڃe۾F vS %)bU~K"%^/R5}t_A3q6Ý:g0JLFM.oy r3Zŏ@HŌI$|<~@NW̮̞]Zs ҜM-X~Qx]]{ GR@y6Cyo+.hEoToY✷JqbG&w]skY]싙qIyUBrytAb0bhL3bV(ͯ>16ǒ{DV~}{.%BELfrvIl>i'(6"60j:Pfs_G HP: vxbcp ?DFk$}I,8[,5v{MU!NpSxKwh1X(cL)*_y31 ?o:2`JV='SիADx̺ry"OMR(o>W AΛa`9(k3ZumnGLyrbڵ9K\ t&tfјXvnV:fzW2Y`=Co}mC_H!׼IfNhQ6/2rXwΈM4u+ԥ׊iqwQ5px3-:TR&1|=7o-t*S񍩂gÒ HP(dϙ ԑl?pPnJ4wpeLyj[oо[W9mRZۜzIS'No)rL- I-:LM? |Zx`^qāH*_ZwxLMUSg`9;hoj@Q9cG'*+]PJ~8fnQeh| >pɋ 0&6>\Bc$pŚBtEAp >kbT| mC[QNFH>CÙo0_+clv*jKwwNN3kdiO3{>pY{"wS䣬`6YN(tvtB+gNō Yg!NTƥT#Տbf Yqp(OvAgNW TΏS^n:TEI[+f1o?Qn+ *v]? 74doU׽:wB؃7eשGaՅ6 DȐ-A)GׄR%C:`˂`P9 ͱ4U-<< <o;TZԏcPGw0F՞^PXRdeJJphkj<+XFKPxz(s WPBNe1|!= %zH\d $&wkFY(O[o#XJT~c=wB֩!|l /]gjr zr8L|VS@nGnX(wA/Md4.痄![v|Gs;.])@r\+ 9B%3c/6Ve#ҐE3cYAkCmIVԲxO[8*ӘՀZ hX--BO½?w@g.O+l!6$^3xL KP0yI?R әYѴɌҫU!{k:P,zBU4;寏w8WjK"mmOVx;I,pYתoӼL9u0y;YQr8}yƆ(It9LT$Gڒh\<%j!)\DKZ9w{\t#g/=0K[D/dMDeu"eDZ\ N4;y6DKO[̽8N"8=JC֌uPODgshNwaQ(䵜͊\ tK@F?Tc.y&ST29teW䮧A@Ga IVtXsz혽F$Ё(<4/ 2xiO>ɈxaUJ{+6?jİCNaմIrrTAzGس+r#2h骍WƂSgPy;ʅ9ĩS  9P/oI 5{XЃxdc`MQX(H\,҂ΰtH?6XmSYn[< GJوgSw@DpKn %SHӰ):D]vOO@\X9ڲn #޻-g|ͥc*(P! >8Q8KE2i50N^},#!O / ʐYMxVOtyks A,C!>7Xָ([0]vj%:-=$irU)f g|å:g@d$&9:q6a I)Et uq[hs;:y1[&,]ABd8gߎ/b|Y(UzE8B_/ZMxؼxzEvhhq^ @'U{9=NPf/օ0$:FCU1ů}~>oK,h5긭ձ3%Tf3eHAdmG{/16fD [w/@rƑ JU7a@)Fۛ&?{: y+3XT'B ؠ]֫(U6q(ϊ~PժhC'eVx`$ĩ3xQ J_- 3X !*d ޫgRчrwN)H<)$ptĠvqQp#5~.E GiFPa(VوtE1[~%1ѐ\޽K_9G+Hkmz$y^uGQwk c|D?wxVP(![Y$2B$'T+,w%Ei>r(Hi4{LPhGՔl,NludҫΑ6Hfvaݖa:6~w`@Tc"~DkJ| Xنhڽ2Z@E+ruEWQ76sEXRUCt$ ,hIy;MnRh LJ򑝅Glrr=jHhACC6Rʆ9gXFL.i qMmE#+9Uנב}+[PD%<-Y5$Y\$ⴧNU\cxoxm'~\QoA:;!BY Mb"FQY\n6)Aͩ3Q/5q/e@n1 188Kq-bL{^*z >zo-3Ei%̇-J;jG`U5o,^čxK8o!-N|>Q3nyCc󌤬NL(yr `΃te"isif{Bt|=@ kCx %f~ccfɯY)=?UCB /.?3@~XEmo?SG$tmRW_pu9xq_^3Ҳ$˞A[,?v\5!Ybk35˱DXTѯ:?hxD""V,4gJBxKH|cnܚ´p} e"J㚇mˀ):fJS8|)R CɦTmʓbZ\'+I\Ky-潍0]̹Ζj+JdKǎ /w<Uh#FiʸΚi01@8XvFFSdXQ,+:(|v1BLz L۵hdh6'\& A57EeGίA,9Z  XTy6?b-,M {Y+=m-/j^cuiU|*jd־BrvW$9gWH5 -:HޔvO{krI _j5ErT/>);a{QLvVcE>^7g))UocZ{q+lp/sVg- EI1>"yn)TH?>] %c&t@cNz"0ϕy[ u#4WFC6-i>M z#'w[ccq'E,jTn#\ Q„.Ȇ^n;ؑ8F,BLP}En"h'aPV1bS{xS~H5J7guŒ>tA.;Rpk m XSU`ܫKe$.5=uȠ"6noAOKH(z@. Pxm/:"ذe(j= +B8Jsp&qc 6>2:V1?N_II_\B,_)5kZE|A|JCMko7IfP>l\_@T.w PѴfMwz+OϯtOM(czw-“ cLs/)XQ|aA1ݨ^yNxL Eݥa"i;o>l$ѓGJ%HJI+y-`+Νe -e:<\!dq?+e/Cs{V#n8w%GyȽ8g 5C9$0b%=dQPT4߷Q9͒JF9 ed/!iXJ  瀶3Y6=Fƌ!Nt\)Ժ_#zr+]=p]$ߥ'RKpi݋7  ,_:kS*0QžX/dQ{'(N+C09,Wo)}O^L(W-PWI,_L,V~yBou7ǤMx<i^H_.ePq|>ҰB],S#釵dnhԆK15qSVkf\>!$Wŗ'ŤͰo5*e+/ w%`'ŏ,Ka>FC5Q=w}XUF ꡂo b<>4!30Dtw#"9\Ey4긗lSY? A~(W}8P&8*Q[{OKFy1I fq+0Rhz1Q#-\g@ q\<$EfɪpLInӛ>g~ _C(=yZ:;p&$)hA&N/\G 'm$K̀!uc\0i^ϴl%Nl`?p )"lɟ/>x~~2FW]M5XkaݤI&QdV)qXi;Tte.^BAð)pCd6t{.Ӊ}|XbpHtqYdMUԝ"UHcxPO>[mi5KD-~#gt=Nje8@ڮFMб+L{5ka _߀;Đ|e;˓D?4 2q$%c9]F8 >Zc;X+mm& B篼Sq_XRI; opas v?(N/A )(ƭ-*)Y-to(mh8o`%WjTrjNڦnLE{;p9CtDm}b @%z3H4.d`-OȄ ^-~@f<Ç<VXH9+LR%#E /p8UO r%PA1xIE!Vx,`R `+Qu)+=3*w^kOݳ`IEho+}IC%1v] Tـ E)'IOv( +F!as mG-}y"~v%ȱ(tc`F,M[b?z'YcOjI4<$1fWNV,US9;o*IRU'ksD7}=p JU",P!A`>JSynBCocبV7XɣҎp3}t1 4u0q` (qz{b-߷5A*E՜sdR+)u./-qYc_|_Q7l-Z?=^OX5C)d![\LJxlSI!4 o~/s>o d4_3mjYg&ĺ.?Q_g%Y1v; *^/"jQw!Z6^rԓLo7MJӱy^ [k.GY%2,C&)ٳ)- ,\bɫ@ !gMB' $2lOoU|)41Ww a.o"}~sD Ȁp&Jj֥esMy9" ؍Dq Pq%R+ Cvc̲CUƢT O}-fD]L4l Lׇhlyh"UIcw͋$3g+Y١Z԰P9~m͎,g=?'z9=d{^H[O9!(ygcLVO;tp*^e+-H&]*Y1Ď|L Ub>ƻN0b˕ps1ѯB+s햌H\ZugIcMn{Z@!ې2܀[-5l:q0 ,.ò5cmEE>9b O um*h̪B1(he ~o%B2H)ֳlÊi^CvXUR&4wMey^x1U~mg?Jfv/KD-|7*T)G/3A,^=7!k,0U~%sSq.7jKq!t 9${2#3 Еh░NV-N1!9?Q' `!0T?e]"v#F.'@XkI'XL۱/&i3y5S f]N24|ʹ_9Ni*m@7Ws7#Hu$R :>+4cZ4 E5,}pVGF_%oF$LOYE"~C7S98t05.*&'1=./N{G/Sjc`̩.b <*8 2Pr[Y=+MP,vRuk`5N&s[Blo$CQK`>boo(18j,rHkSӋ >xZ$rvKKcKJAaЭ@ NLйJts" 0rSi")*n#iU*-:^{ҴY}5xWR 7A2H%ի9df<Z\5(+s&J6?iJ6#'n?]IJ|'jl>?*)*ފS{;pxe8)&EqDp e7Y"'"_QBJ{ō%x[#v)DKܰK&Sr:8`ñ[RϾ}Or@Jy m=Hr "a_k-qg y`a+l@{FjdmH˹;.!K;:-rR6$w>y|)]Bj >K_&(xķa02v>Y2gعR{QG85ViU,drZt&BJX٪`E6/twrd >9!6z|IG+w5{ybJePm=v+ڄdMkvD"1664o?g)E2 PKԑ MԜXp#7^q }V^u}>儣ˀo}bm"Eaʿ@/`+Ȗwً+c#$QQzV!#waO+$) p 672 enV̑ f0*O6J`PXh ڳIq>8mу%rqu #'JJL`?|eVsx}I#lMj$:)Le`LvN!Qn<p+ptAȗ;1 Tc۲h ,:Ig\i뀷O T0q 'ҧ%2>R:7VZ$W6 ԡQ[վoؿ¨N9>ޢYfxǏKoCϓpJn4wn䗺؝/!oz5#EE~B LKzDd@Iឈqxjjc@`{Q2"e#pf`_ZUUL*}vD)|iL՟DrZ^]֓>=%Jdz7Cc X^јo^P@@`'1B`Zo)n%̗z1XI^/^P (ŶYL^Goc](W64^hD%$˿P#eeuDyBfJsMx]*+]Qk` [ 62 챇 $DyLp G`Ȧ`z;A<)?d졖,O]&\47}&-dYY9I͚5}327|rHflmJ:){b9yXpZL 8^ {/bYjGTX~X1SkR0_D?s!۲fdoJ5$pmK!#-yQΙ4$٤x M^^U KsZNZwFD_q#r1'Z;E_Ub"pq0,qw'Wl^o3F=#\,^.c k&Fa熍-e(F FRxO(}UƓWfTC'({C^;t.Oo=<5LE? z%$U?Q4C :]vY<r[ _pj1vJD4{`F%*aU9k2~v BBouYKt)w>Ve{RsZu#Ϩ oU`ɆL>0 >kIKR: g=lȾ-|YYeԜ&)M/ HbVgm2Ol50~B˿4cp#¼MiWLC'u,ed>7 0j?CC] YPS-0pWEpɚw6#$s`s7Շ˕ ]o]Kd-5ȡ1]u--2 > G%D*.l-Hyj$kvJNS 3Xa݃C›"yÀ=]ΤC3.^Wiۻ2flU?sfj4+|auZ]nrBxFv֡Ґ) :ߎuc:"'\Rp-ZFRS q֔R n\i``n&+pw:HQVlybȰ;@R5ȯ{t4h D>zk=Mw1/W!u%@Š7]&c.gʴu(!;UejJ[)Hg `>kp\bTHFlg> Ͽ ͱkQ=63L..̛bSNθֱoVhzHLؔ=bS(7*3Խ4gnј6F&1A89N}9IӱJgh3R˼os'N#H0oq2Τۀ_#80TLdOFL)DTAٮV#M=!=ӖSY_dq3JfI18MYWwQ\Bp,wEkayN30-\rLكi2 5^2FܥgxI 3a/W~yz2ESήUc-rck f  -go0+h@O==`;RTXx vJXSdB!f,.QCƩөIQ}&ytfea#PO/ӯ&荃Km= l5z,*0QZEb̷ OQhKGI6d>3GP"JPvύG?$)lħ,剐$k!#,^"e\7Rzq*ʸ|aGp|;].]|*'.̑N<m| [r|;!!W]$M /J_\yblnNC/>LCbyh9f 5(~"H22^`m4tοX33 {AY5 s. +(txdE=zG۳4{[XD`.:=-^ ޅ/zyۆ$\%=Ti)RnLI2;&#--֢WCU=#q^D+aW3.?`uQ+`IUBWK(O@!A>:\ҐEՑ :9+V3+\-`<~wrʺ BK!ٚg^ ;o!ǃpZ9Z A&¿m<UYHv 2VKA =|r&J?TKڲ$"#Գurէќ߼[֪>AQcYOϹ+:0.60Yk Bo!%o0x:!ESJ܍ј W0[ɬwӟ3}?iEQҪ#wq5[2njZv,0q,$29i],}Tĕ/p c+9/L+ <zn9y08CR h{B@µXbϯp[I%hjd\#餽2:lOƄ({s mwr]hȆc1GnOf|ς<I)\ջfz.qi7Ӄrq_i32}8Ne~Z= wA3x:w/4c*Q,=T@M <12G|5 p-z^P`Mrn"@hq_ej=`<KЂ4`~T&VIWܸIyűyYP|VF)kԗ QU6bkw#2A՜}S`(ݫu Ύ;g:7Ct~9k^ʭu ?XlgN 9l%+@IY\Epz]iώ0}+XQX̝.q+ʠ[{e SమJekOtQb6]s~/{b(#X%^34~NpU;iǮ%mڷ&9U~h.ȴ!]MgKfW.SBϯ{ǔ~ְ6C`͡?15+c? 56#{T*i >"M(B~$œS<.G: LdZl1IOI%.@́lhGn^?b_3b\Д=v<>Z勿lR\.|Ć*i$3qlV|>5zx)6 2X@egq7 %SR oѼG|v#{5W6A8祉HUj ^gDʰ:;})!d63}\'#ⵋd Jl' BGJ,A̻3ETyPDجס2zh|i_ Hx-ӵGLH~D2-++Ju"JNѱ 0ip5E=?(2492r }:`0>w,$vP (?XL(ѬՕjT$|nTT"L, kS{C_odN$XǜAL QWN&F%.r3*Dҙ ɸcwǏJBvП JSvH)NbdGz 1k N~~ahM=_؈;Sk2GA(C|\3N *Y7g=mI~ʘ|},ПA_"Λ́٫UF<,4~c$h19}E8Q;Y|xDL.jp!!o\ (ވNJ,Hg@cS\fN1(O2UrQrsZ鴊2cWՏ w락-9[7A"u ]nubހ.p>ǴN[= "4bYf`ȷD./YCZ❮u),0)u`2uۏh+ǹǽq,w5y2wd9|A YɔRsQ!zF沢4nrzItim `e&BPΐ#)B=9ZQ0;4#w+Rݛ/"ciCSCFß:%3JfbCp]\`9tavQTj>}A*ٱ xf˚rhǑ`6qrξ F bl)(j0}F9Yf(o__8dkVs@2VuD~8l5|M WNN\,ڀ㳡o]NҀ[QP/$=p:LB:~if,EM W:u()<4_K_k\2Q-l7Ϗ;oLJLi^\Cw+S,H97O4S~s!t [ABFu24S9,4 -)M_VP1BuԑVBNzl ,\_imgpj "T| !s謭4af`"eť/#/0 1"lDl`iww$1];I%_TY5^C3ЌwMMW-^9sF]o ^/Z.TO}Fq`@#NZRhc/cK?NYߒE\u"ǻ=?[]dG_@YvN2isݖAF5W `-T@SaoKmӑdDN`N45XWb_EӦtJ嵈1x!{tKr?U&Έ%LmUꄿ"=UAg;~*н6> &:؆p}$(+0|@F*G+J|ƾh!c4` ϟFc(4o2 izMs|C]ɸj߸g]U9r0'I=э%p\_(AflQ 6\Q;$*^ JL ת+V n#,ZZ4B9%眭ةddQ$j럫'[VSTXvPU#%XE6B=a Ч9\}YU;3S6 5nk4J!J<qN!E-z,c[z|TFGSzn('cCV0t8Xp"yC튷Gv]||xiha!(e@/1xo,Y('yl#lz4C(MNig?#uˏ,v=?5b3ZbCPu͔%9JvGu['@%iožA`Zr^P6`ٽ0?8XRW#:i (-{-'|-⺕YH7_zF,b5qk>5&v_%RYdڶ4 *vŽY Š4p?{0iepIT*q]2QXmC=~\*" t MuP4% _U{Y0S?|*ZW~{C߉KirM۰}&yWc\c3<+ 5 h@:/s"4 P21D!&ْaJEn` m,-a+;CTx?x n-5sPg3Es㕰F':1xEv,׷5Y vl͂(۩ eLPӧl-h9,( 23+w!LH1A\gf4*hC,-Bb|Syvf90sS1|U /Cʎ)Bn-Y7p! W㚾o̖·Rd-oFvj' 0Xh,c{̜4?}(}Ro>IY"&X4z^Y 嬲qu w:RBWǻXK1AfUMC^2?>Wq2r GNf+bFǿKݫGuija=)~XLZP0]U9tyH:6_1%ԛUm}/V1!?PcN,NaɠQ$;ƒ73rǾ<#pyb-.lثEE1NɜP`Fӯ4-!c?i=Xu%/M^HsLTkZMg75ԘPAmޟIQH>7BtXƚQ|&VyRX5@p `BzsN-zZ_:B BUJ>1;3~--GBY <#7*s$:*o 0vA,h@`ѯDuFo{2*i -%7B58\Z 託5!9oD>b%}$ڲk7IQclcL̺ԩaYFk"~"6켫)N{0x󆇽u%Kyhq;|ET(R=R尿<¸dyJh!T~k>J 9tb`DF4ۺe&3M7 ˗p;;҇Bd|GfYd`9n]JF㛎*=VLGBz!Gsdu(l]2mjW~;Q:ֹ`« bIapm,N4}K/ #dR:$ o͐{?)|]M(9e02M5Ѭ~ ˬx8aLDt1NPߜ;COϷOgKbU\װ LIWIa1#Ma 3<{O: yffbt\HU~gYdqӿٍvF*08wlT[n\D3B$䪺k6FtZt46ۼcIk GtLɩ -t؊7LF1l5E{6O.x, H EjS=-%N~[jp}eW??;Lꎤ Ԟ3 7B#T~Qn<,P̷;>ӂbtk|5?W V'[~GňP U g$̊)(5SB;<[T6kz&< hS2ˣ)#fj&vRK῭:Tã w(6@Sg7S1mDČA[yC,0rӐ1!hţ!e쒷:xO 'ט'-`O6oAsƛ o\MiuA,4BF{y(UuD lK%O9. v[xFPv4EB*tIp/.۩, ٚ)!}&HU@x|$gX4 T/#<ŷ,HP֮p\*lO_-Q]6*H\`{c=FnO+KO@s3z@!Niяȿ] {Ä.k7t1ci]MbL _ՂX}9W&wI5j*#_{P?G"asLˋlܕj4 l tS*4,R&"8 ߉B ~U󈎤N NZuFq|]%\_)j^d~7`GZ8kE5LuEwGV~m廓wJrheOHYlJۮ%P}Yƚhnr@ID-@6n&wk<8.("EqլYNlUg=̇x*;[7-ﭽAO[mG QW.BI"Ep8WӮp8a p!ʊ_,Ldh:.Qϖ۽Fdr~;O6Z&&1)fuSzmϰ]ZR]CqHٯgZmnb0L-m_uI9%q)%VTY6m DTQIeH,܍>.(#OnVPܰE/m<'ο/QT"8&F?ϸ2l`~O4V䗏*McBDrEEܺ% )Xl%.R[1H|on^j7xfDR#|&˿mQsrh?[kn\?Hͯ)zaF?sĝLu/^ӳ/hIGH$YWہ`joFJ'Z.M*%_FD+ң\=#g?{~~,۠7K A1nKj:0B29;/4dI $L6[wgLkP Э}kl2L7+1c1z9N%]օC\*-S{d(ѺֵɏnMLl\^PϫT$+ZU-rW% uoO/q] 2D$f ɔVS&i&uf\q_׊rf ]D0q- =F[kl]DH#p0nf.m)#S#SY e$Km0Ex39H*:l$$sʿӆ"ZqKH,eqUA'L\^|xݹlY(,z2fɧA:sv3ETevN[n o!DQ3")ϬS L B~g8*k&V/.Up*3 B?5[ Bty T ӌ&(i=;ߠg 6oWKF, k~w2+P JWP!#R[%*ϛ^`?3>OD2wL^ᩬ>,uGL4JϏ-9!B=&U b Et{hӛhrOa͐&/O CT; D&`a6C ۿ'7?_B?C!vޒ}ဨY'3=&ĵ%32Zbo:Ì ZʡJu~)rdRy UM0`q6ʌ1 /W>9J#_6ZXg5Ix%k Vv]ng쮌C:ˇuqL2Q- C'D7yeߚoOt4o6Pͽ.F#MTo.xr9 U0}RoS* @!3=48#MͯJȄb^c>_Ń4x[j}'>&3:c<76w{I]ܤSv.لv@Aױc7P֐F;5 מ ɖ7N"|j8 [X{2H>`'?CEȲ-;1"I]+õ Xf^RSG_iH :R{ZnA:P>-cϿ=5ln8bi3gjbQSOty?Ȁ:Q K1e(!0Ո+p].%%0hߒ-?٬d6Gdb, BOM@?fVB -W1oQ}.3|&&*+E'ħۆFT^K3ٱYO#p4;Fѧ q O4 jvrҸPBKמ"$ctlIء"+EeӵyF! vLAZcppIڡ!O "mRk2"C']\?EҧK%.SUFσ쑻t9 @dn%4_16jPR ږ\iGEOSRwUK{~VA(,ՑHNQݓ-KyMv~ꇱ"tN^$6܁@'WLlx<=)Nc=|..G<%Agݭ&m~NATM< w \jgW#k l+E7SDS %tM:?Ks?&-ԹS|Vj0co-\s `< $/Y!.~3b' ٵ(5BdV'2P󶮌so7˦w.~Gq1j?H1^Yy57[8|J{XoUuq 47ݪ8Yr;}$~, o$Mo%`cHU_TB%@(c^fQr$\?EJcg26Gj(<Z]=W:vѶGKjpa gSg6`Nlc߃4ޜQk=gz*YئMj}00giܺa;X]ZQ :`M c4@?~Q=Tiyˆ0N5y_ &z V*ۀORc%U.k}# g;dzzގ Y ƫlҖ8,ڸPp@ kǍ]/JsʍqӵMjnq\ꆌ[B m\(QuՈCN&^ ض ̃ .HMnT̗|OAcMzN G#+ !piOۛZH78 Mo^/kc}Uky:\ _Kw>(}wPVfPBATCN((L&Zj t(:I_7>| -Js2tdyԔX*D#bW#Ž>֎T2`,r#SJ33f}J }|ҕ2&EmiAeuD1NJm-%qh$%B^PaQ : O yWyƽmA{gc{YB>kjL60N6B܃m>GEv-J+r9g}NTG͞"Մw,.I܄42L].Uz_C`̺fG"{.&6~ض.'F_ej5NYQS3lgJo&Lh ܯÀ[27k)7gy1K|( }W)hȔG$,zK(~Ff(Xx_%5Lk| {>uSE3F(t:*Lh̤JD"]ji|sFX<1Z'':ROZe?RFkR!..d^{e %?RCٚi#Ғ>_^tyFExP>(7fx@Y(0~n`X4tgTJ6>ZN` ﾰ"jn #7 ήq#xtg 7[*V:1aabu$w\:yd xD.^ٗ!SˑQәJ O;KblVb! heT|nV"ɖܲi קN  |& ;jsC=e%]uEfrO/d; 0#fʔ*M]r`]rOcq1O._ous.N .NILGZc=gskEDR6X˦3cf5=/MgT{RVɇ|ϗCj}n|$vrLcT5|h,Rh%z|땑3_}QmRDO& O eLYFBb[^u]c#ؕ\Dezʖ?4G 20I+ YZ